TB Genome Annotation Portal

Rv2058c (rpmB2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 50S ribosomal protein L28
  • REFSEQ: 50S ribosomal protein L28
  • PATRIC: LSU ribosomal protein L28p
  • TUBERCULIST: 50S ribosomal protein L28 RpmB2
  • NCBI: 50S ribosomal protein L28 RpmB2
  • updated information (H37Rv4):
    • gene name: rpmB2
    • function:
    • reference:
• Type: Not Target
• Start: 2314825
• End: 2315061
• Operon:


• Trans-membrane region:
  
• Role: II.A.1 - Ribosomal protein synthesis and modification
• GO terms:
  • GO:0030529 - not-found (Uniprot)
  • GO:0022625 - cytosolic large ribosomal subunit (Uniprot)
  • GO:0006412 - translation (Uniprot)
  • GO:0005840 - ribosome (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0003735 - structural constituent of ribosome (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6DZI	82%	Mycobacterium smegmatis str. MC2 155	Cryo-EM Structure of Mycobacterium smegmatis 70S C(minus) ribosome 70S-MPY complex
  6DZP	81%	Mycobacterium smegmatis str. MC2 155	Cryo-EM Structure of Mycobacterium smegmatis C(minus) 50S ribosomal subunit
  6SPG	52%	Pseudomonas aeruginosa	Pseudomonas aeruginosa 70s ribosome from a clinical isolate
  6SPF	52%	Pseudomonas aeruginosa	Pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate
  6SPD	52%	Pseudomonas aeruginosa	Pseudomonas aeruginosa 50s ribosome from a clinical isolate
  6SPB	52%	Pseudomonas aeruginosa	Pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in uL6
  6YSI	51%	Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841	Acinetobacter baumannii ribosome-tigecycline complex - 50S subunit
  6YHS	51%	Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841	Acinetobacter baumannii ribosome-amikacin complex - 50S subunit
  6V3D	51%	Acinetobacter rudis CIP 110305	Cryo-EM structure of the Acinetobacter baumannii Ribosome: 50S subunit
  6V3B	51%	Acinetobacter rudis CIP 110305	Cryo-EM structure of the Acinetobacter baumannii Ribosome: 70S in Empty state

• Links to additional information on rpmB2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = ? (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LSAHCQVTGRKPGFGNTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVIDRDGIEAVVARLRRQGQRI

Additional Information