TB Genome Annotation Portal

Rv2031c (hspX)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: heat shock protein hspX
  • REFSEQ: heat shock protein hspX
  • PATRIC: 14 kDa antigen (16 kDa antigen) (HSP 16.3)
  • TUBERCULIST: Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen) (HSP16.3)
  • NCBI: Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen) (HSP16.3)
  • updated information (H37Rv4):
    • gene name: acr/hspX
    • function: alpha crystallin; highly up-regulated in hypoxia (in dosR regulon)
    • reference:
• Type: Not Target
• Start: 2278498
• End: 2278932
• Operon:


• Trans-membrane region:
  
• Role: III.B - Chaperones/Heat shock
• GO terms:
  • GO:0075136 - response to host (Uniprot)
  • GO:0071456 - cellular response to hypoxia (Uniprot)
  • GO:0052572 - response to host immune response (Uniprot)
  • GO:0051409 - response to nitrosative stress (Uniprot)
  • GO:0046777 - protein autophosphorylation (Uniprot)
  • GO:0045926 - negative regulation of growth (Uniprot)
  • GO:0044183 - protein binding involved in protein folding (Uniprot)
  • GO:0044121 - growth of symbiont in host organelle (Uniprot)
  • GO:0010039 - response to iron ion (Uniprot)
  • GO:0009408 - response to heat (Uniprot)
  • GO:0009267 - cellular response to starvation (Uniprot)
  • GO:0006457 - protein folding (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0001666 - response to hypoxia (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2BYU	38%	TRITICUM AESTIVUM	Negative stain EM reconstruction of M.tuberculosis Acr1(Hsp 16.3) fitted with wheat sHSP dimer
  6EWN	37%	Thermosynechococcus vulcanus	HspA from Thermosynechococcus vulcanus in the presence of 2M urea with initial stages of denaturation
  5DS2	35%	Pisum sativum	Core domain of the class I small heat-shock protein HSP 18.1 from Pisum sativum

• Links to additional information on hspX:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.924 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR
TVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Additional Information

also known as acr (alpha-crystallin), highly up-regulated in hypoxia (in dos regulon)

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	0.88 (0.07)	1.2 (0.37)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link