TB Genome Annotation Portal

Rv2028c (-)

Amino Acid Sequence

MNQSHKPPSIVVGIDGSKPAVQAALWAVDEAASRDIPLRLLYAIEPDDPGYAAHGAAARKLAAAENAVRYAFTAVEAADRPVKVEVEITQERPVTSLIRA
SAAAALVCVGAIGVHHFRPERVGSTAAALALSAQCPVAIVRPHRVPIGRDAAWIVVEADGSSDIGVLLGAVMAEARLRDSPVRVVTCRQSGVGDTGDDVR
ASLDRWLARWQPRYPDVRVQSAAVHGELLDYLAGLGRSVHMVVLSASDQEHVEQLVGAPGNAVLQEAGCTLLVVGQQYL
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.170550;
5 non-insertions in a row out of 13 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000050;
4 non-insertions in a row out of 13 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000100;
4 non-insertions in a row out of 13 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 13 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 13 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.97
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2028c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    CitationComparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. J. Starck, G. Kllenius et al. Microbiology (Reading, Engl.) 2004priti.prietyIEP15528667Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    CitationRole of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. authors,BM. Altura Prostaglandins Med 1978priti.prietyIEP102004Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
    Citation[Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova Biofizika nullpriti.prietyIEP93Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv3133cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

    Comments