TB Genome Annotation Portal

Rv2026c (-)

Amino Acid Sequence

MSAATAKYGILVGVDGSAQSNAAVAWAAREAVMRQLPITLLHIVAPVVVGWPVGQLYANMTEWQKDNAQQVIEQAREALTNSLGESKPPQVHTELVFSNV
VPTLIDASQQAWLMVVGSQGMGALGRLLLGSISTALLHHARCPVAIIHSGNGATPDSDAPVLVGIDGSPASEAATALAFDEASRRRVDLVALHAWTDLGM
FPVLGMDWREREKREAEVLAERLAGWQEQYPDVRVHRSLVCDKPARWLLEHSEQAQLVVVGSHGRGGFSGMLLGSVSSAVAHSVRIPVIVVRPS
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2026c/-, gene len: 884 bp, num TA sites: 12
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.57)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.739)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.77)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?YES
omega peak height (95%CI lower bound)2.5 (1.23)
codons under selection1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2026c/-Rv0324/-1.49
    Rv2026c/-Rv0023/-1.4
    Rv2026c/-Rv1990c/--1.17
    Rv2026c/-Rv2887/--1.45


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2026c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
    Citation[Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova Biofizika nullpriti.prietyIEP93Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    CitationComparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. J. Starck, G. Kllenius et al. Microbiology (Reading, Engl.) 2004priti.prietyIEP15528667Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    InteractionActivatedBy Rv3133cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    CitationRole of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. authors,BM. Altura Prostaglandins Med 1978priti.prietyIEP102004Coexpression(Functional linkage)
    InteractionActivatedBy Rv3132cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978

    Comments