Rv2006 (otsB1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: trehalose-phosphatase
- REFSEQ: trehalose-6-phosphate phosphatase OtsB1
- PATRIC: Uncharacterized glycosyl hydrolase Rv2006/MT2062 (EC 3.2.1.-)
- TUBERCULIST: Probable trehalose-6-phosphate phosphatase OtsB1 (trehalose-phosphatase) (TPP)
- NCBI: Probable trehalose-6-phosphate phosphatase OtsB1 (trehalose-phosphatase) (TPP)
- updated information (H37Rv4):
  - gene name: otsB1
  - function:
  - reference:
Type: Not Target
Start: 2252002
End: 2255985
Operon:

Trans-membrane region:
Role: III.E - Adaptations and atypical conditions
GO terms:
- GO:0030246 - carbohydrate binding (Uniprot)
- GO:0016798 - hydrolase activity, acting on glycosyl bonds (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0005992 - trehalose biosynthetic process (Uniprot)
- GO:0005975 - carbohydrate metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- TREHALOSEMONOMYCOLATE[P][c] -> PI[c] + TREHALOSEMONOMYCOLATE_40_CY_41_[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

5GVX 56% Mycobacterium tuberculosis Structural insight into dephosphorylation by Trehalose 6-phosphate Phosphatase (OtsB2) from Mycobacterium Tuberculosis
Links to additional information on otsB1:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.444 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
5GVX	56%	Mycobacterium tuberculosis	Structural insight into dephosphorylation by Trehalose 6-phosphate Phosphatase (OtsB2) from Mycobacterium Tuberculosis

Amino Acid Sequence

VRCGIVVNVTGPPPTIDRRYHDAVIVGLDNVVDKATRVHAAAWTKFLDDYLTRRPQRTGEDHCPLTHDDYRRFLAGKPDGVADFLAARGIRLPPGSPTDL
TDDTVYGLQNLERQTFLQLLNTGVPEGKSIASFARRLQVAGVRVAAHTSHRNYGHTLDATGLAEVFAVFVDGAVTAELGLPAEPNPAGLIETAKRLGANP
GRCVVIDSCQTGLRAGRNGGFALVIAVDAHGDAENLLSSGADAVVADLAAVTVGSGDAAISTIPDALQVYSQLKRLLTGRRPAVFLDFDGTLSDIVERPE
AATLVDGAAEALRALAAQCPVAVISGRDLADVRNRVKVDGLWLAGSHGFELVAPDGSHHQNAAATAAIDGLAEAAAQLADALREIAGAVVEHKRFAVAVH
YRNVADDSVDNLIAAVRRLGHAAGLRVTTGRKVVELRPDIAWDKGKALDWIGERLGPAEVGPDLRLPIYIGDDLTDEDAFDAVRFTGVGIVVRHNEHGDR
RSAATFRLECPYTVCQFLSQLACDLQEAVQHDDPWTLVFHGYDPGQERLREALCAVGNGYLGSRGCAPESAESEAHYPGTYVAGVYNQLTDHIEGCTVDN
ESLVNLPNWLSLTFRIDGGAWFNVDTVELLSYRQTFDLRRATLTRSLRFRDAGGRVTTMTQERFASMNRPNLVALQTRIESENWSGTVDFRSLVDGGVHN
TLVDRYRQLSSQHLTTAEIEVLADSVLLRTQTSQSGIAIAVAARSTLWRDGQRVDAQYRVARDTNRGGHDIQVTLSAGQSVTLEKVATIFTSRDAATLTA
AISAQRCLGEAGRYAELCQQHVRAWARLWERCAIDLTGNTEELRLVRLHLLHLLQTISPHTAELDAGVPARGLNGEAYRGHVFWDALFVAPVLSLRMPKV
ARSLLDYRYRRLPAARRAAHRAGHLGAMYPWQSGSDGSEVSQQLHLNPRSGRWTPDPSDRAHHVGLAVAYNAWHYYQVTGDRQYLVDCGAELLVEIARFW
VGLAKLDDSRGRYLIRGVIGPDEFHSGYPGNEYDGIDNNAYTNVMAVWVILRAMEALDLLPLTDRRHLIEKLGLTTQERDQWDDVSRRMFVPFHDGVISQ
FEGYSELAELDWDHYRHRYGNIQRLDRILEAEGDSVNNYQASKQADALMLLYLLSSDELIGLLARLGYRFAPTQIPGTVDYYLARTSDGSTLSAVVHAWV
LARANRSNAMEYFRQVLRSDIADVQGGTTQEGIHLAAMAGSIDLLQRCYSGLELRDDRLVLSPQWPEALGPLEFPFVYRRHQLSLRISGRSATLTAESGD
AEPIEVECRGHVQRLRCGHTIEVGCSR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.020500; 6 non-insertions in a row out of 82 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.066900; 6 non-insertions in a row out of 82 sites
Uncertain	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.082450; 6 non-insertions in a row out of 82 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999900; 17 non-insertions in a row out of 82 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.995100; 13 non-insertions in a row out of 82 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.5
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0302 (-) (Direct binding)
- Rv0678 (-) (Direct binding)
- Rv1985c (-) (Direct binding)
- Rv3133c (devR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	Three pathways for trehalose biosynthesis in mycobacteria. KA. De Smet, A. Weston et al. Microbiology (Reading, Engl.) 2000	njamshidi	IDA	10658666	PMID: 10658666
Term	EC:3.1.3.12 Trehalose-phosphatase. - IDA	njamshidi	IDA	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Term	TBRXN:TRE6PP trehalose-phosphatase - IDA	njamshidi	IDA	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Citation	Three pathways for trehalose biosynthesis in mycobacteria. KA. De Smet, A. Weston et al. Microbiology (Reading, Engl.) 2000	njamshidi	ISS	10658666	PMID: 10658666
Term	EC:3.1.3.12 Trehalose-phosphatase. - ISS	njamshidi	ISS	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Term	TBRXN:TRE6PP trehalose-phosphatase - ISS	njamshidi	ISS	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	RegulatedBy Rv3133c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3133c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	probable trehalose-6P-phosphatase, apparently inactive in MTB: INVOLVED IN TREHALOSE BIOSYNTHESIS FROM GLUCOSE 6-PHOSPHATE AND UDP-GLUCOSE	mjackson	ISS		Trehalose biosynthesis
Name	probable trehalose-6P-phosphatase, apparently inactive in MTB: INVOLVED IN TREHALOSE BIOSYNTHESIS FROM GLUCOSE 6-PHOSPHATE AND UDP-GLUCOSE	mjackson	IMP		Trehalose biosynthesis
Citation	Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005	extern:JZUCKER		15653820	Inferred by a human based on computational evidence
Term	EC:3.1.3.12 Trehalose-phosphatase. - NR	extern:JZUCKER	NR		Inferred by a human based on computational evidence K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005

TB Genome Annotation Portal