TB Genome Annotation Portal

Rv1991c (mazF6)

Amino Acid Sequence

VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASL
MHEVDRGLRRVLDL
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1991c/mazF6, gene len: 344 bp, num TA sites: 6
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=1.14)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.088)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.11)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.4 (0.22)2.0 (0.5)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1991c (mazF6)

    PropertyValueCreatorEvidencePMIDComment
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113MazF homolog, Toxic when expressed in Msmeg, rescued by antitoxin (Rv1991A)
    SymbolmazF-mt3jlewmRNA levels elevated in Mtb in limited O2.. No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down.
    authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye Noncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. J. Biol. Chem. 2010
    CitationNoncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye J. Biol. Chem. 2010jlew20876537mRNA levels elevated in Mtb in limited O2.. No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down.
    SymbolMazF6jlewToxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    SymbolmazF-mt3jlewCaused cell growth arrest when induced in Ecoli.
    authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationCharacterization of mRNA interferases from Mycobacterium tuberculosis. authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye J. Biol. Chem. 2006jlew16611633Caused cell growth arrest when induced in Ecoli.
    CitationExpression of Mycobacterium tuberculosis Rv1991c using an arabinose-inducible promoter demonstrates its role as a toxin. P. Carroll, AC. Brown et al. FEMS Microbiol. Lett. 2007jlew17623030Expression of Rv1991c inhibits growth of EC but not when expressed with adjacent antitoxin and expression of 1991c in Msmeg resulted in reduction of cell viability.
    CitationBiochemical characterization of a chromosomal toxin-antitoxin system in Mycobacterium tuberculosis. L. Zhao & J. Zhang FEBS Lett. 2008jlew18258191show it's a toxin with ribonuclease activity. Rv1991c and Rv1991A form a complex that can bind its own promoter.
    Otherstart:2234305rslaydenConserved hypothetical protein, showing some similarity to P13976
    Otherstop:2234649rslaydenConserved hypothetical protein, showing some similarity to P13976
    Otherstrand:+rslaydenConserved hypothetical protein, showing some similarity to P13976
    Otherstart:2234305rslaydenPEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
    Otherstop:2234649rslaydenPEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
    Otherstrand:+rslaydenPEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
    Otherstart:2234305rslaydenYDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.
    Otherstop:2234649rslaydenYDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.
    Otherstrand:+rslaydenYDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.

    Comments