Rv1988 (erm(37))

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: methyltransferase
- REFSEQ: methyltransferase
- PATRIC: rRNA adenine N-6-methyltransferase (EC 2.1.1.48)
- TUBERCULIST: Probable 23S rRNA methyltransferase Erm(37)
- NCBI: Probable 23S rRNA methyltransferase Erm(37)
- updated information (H37Rv4):
  - gene name: erm(37)
  - function:
  - reference:
Type: Not Target
Start: 2231680
End: 2232219
Operon:

Trans-membrane region:
Role: IV.H - Miscellaneous transferases
GO terms:
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0032259 - methylation (Uniprot)
- GO:0031167 - rRNA methylation (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0008649 - rRNA methyltransferase activity (Uniprot)
- GO:0008168 - methyltransferase activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0003723 - RNA binding (Uniprot)
- GO:0000179 - rRNA (adenine-N6,N6-)-dimethyltransferase activity (Uniprot)
- GO:0000154 - rRNA modification (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

6NVM 35% Saccharopolyspora erythraea Crystal structure of 23S rRNA methyltransferase ErmE
Links to additional information on erm(37):
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.232 (from Jeremy Rock's lab)
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
6NVM	35%	Saccharopolyspora erythraea	Crystal structure of 23S rRNA methyltransferase ErmE

Amino Acid Sequence

VSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANP
PYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Ancestral antibiotic resistance in Mycobacterium tuberculosis. RP. Morris, L. Nguyen et al. Proc. Natl. Acad. Sci. U.S.A. 2005	harsharohiratruefriend	IEP	16103351	None
Interaction	Regulatory Rv3197A	harsharohiratruefriend	IEP		RP. Morris, L. Nguyen et al. Ancestral antibiotic resistance in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Molecular basis of intrinsic macrolide resistance in the Mycobacterium tuberculosis complex. authors,K. Burinkov,F. Doucet-Populaire,O. Dorson,A. Gondran,JC. Ghnassia,J. Weiser,JL. Pernodet Antimicrob. Agents Chemother. 2004	harsharohiratruefriend	IEP	14693532	None
Interaction	Regulatory Rv3197A	harsharohiratruefriend	IEP		authors,K. Burinkov,F. Doucet-Populaire,O. Dorson,A. Gondran,JC. Ghnassia,J. Weiser,JL. Pernodet Molecular basis of intrinsic macrolide resistance in the Mycobacterium tuberculosis complex. Antimicrob. Agents Chemother. 2004

TB Genome Annotation Portal