TB Genome Annotation Portal

Rv1967 (mce3B)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: virulence factor Mce family protein
  • REFSEQ: MCE-family protein MCE3B
  • PATRIC: MCE-family protein Mce1B
  • TUBERCULIST: Mce-family protein Mce3B
  • NCBI: Mce-family protein Mce3B
  • updated information (H37Rv4):
    • gene name: mce3B
    • function:
    • reference:
• Type: Not Target
• Start: 2210601
• End: 2211629
• Operon:


• Trans-membrane region:
  
• Role: IV.A - Virulence
• GO terms:
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5UW2	35%	Escherichia coli O157:H7	Structure of E. coli MCE protein MlaD, periplasmic domain
  5UW8	35%	Escherichia coli O157:H7	Structure of E. coli MCE protein MlaD, core MCE domain

• Links to additional information on mce3B:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.399 (from Jeremy Rock's lab)

Amino Acid Sequence

MRENLGGVVVRLGVFLAVCLLTAFLLIAVFGEVRFGDGKTYYAEFANVSNLRTGKLVRIAGVEVGKVTRISINPDATVRVQFTADNSVTLTRGTRAVIRY
DNLFGDRYLALEEGAGGLAVLRPGHTIPLARTQPALDLDALIGGFKPLFRALNPEQVNALSEQLLHAFAGQGPTIGSLLAQSAAVTNTLADRDRLIGQVI
TNLNVVLGSLGAHTDRLDQAVTSLSALIHRLAQRKTDISNAVAYTNAAAGSVADLLSQARAPLAKVVRETDRVAGIAAADHDYLDNLLNTLPDKYQALVR
QGMYGDFFAFYLCDVVLKVNGKGGQPVYIKLAGQDSGRCAPK

Additional Information