Rv1963c (mce3R)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: tetR-family transcriptional repressor mce3R
- REFSEQ: transcriptional repressor (probably TETR-family) MCE3R
- PATRIC: Transcriptional repressor Mce3R TetR family
- TUBERCULIST: Probable transcriptional repressor (probably TetR-family) Mce3R
- NCBI: Probable transcriptional repressor (probably TetR-family) Mce3R
- updated information (H37Rv4):
  - gene name: mce3R
  - function:
  - reference:
Type: Not Target
Start: 2205582
End: 2206802
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0045892 - negative regulation of transcription, DNA-templated (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0019216 - regulation of lipid metabolic process (Uniprot)
- GO:0016042 - lipid catabolic process (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0003700 - DNA binding transcription factor activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0000976 - transcription regulatory region sequence-specific DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4ME9	42%	Bacillus cereus	Crystal structure of a transcriptional regulator, TetR family (BCE_2991) from Bacillus cereus ATCC 10987 at 2.50 A resolution
3F1B	40%	Rhodococcus	The crystal structure of a TetR-like transcriptional regulator from Rhodococcus sp. RHA1.
6O6P	40%	Mycobacterium tuberculosis	Structure of the regulator FasR from Mycobacterium tuberculosis in complex with DNA
6O6O	39%	Mycobacterium tuberculosis	Structure of the regulator FasR from Mycobacterium tuberculosis
6O6N	39%	Mycobacterium tuberculosis	Structure of the regulator FasR from Mycobacterium tuberculosis in complex with C20-CoA
6G8H	38%	Bradyrhizobium diazoefficiens	Flavonoid-responsive Regulator FrrA in complex with Naringenin
6G8G	38%	Bradyrhizobium diazoefficiens	Flavonoid-responsive Regulator FrrA in complex with Genistein
6G87	38%	Bradyrhizobium diazoefficiens	Flavonoid-responsive Regulator FrrA
3VPR	38%	Thermus thermophilus	Crystal Structure of a TetR Family Transcriptional Regulator PfmR from Thermus thermophilus HB8
3BCG	37%	Escherichia coli K12	Conformational changes of the AcrR regulator reveal a mechanism of induction

Links to additional information on mce3R:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.209 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MASVAQPVRRRPKDRKKQILDQAVGLFIERGFHSVKLEDIAEAAGVTARALYRHYDNKQALLAEAIRTGQDQYQSARRLTEGETEPTPRPLNADLEDLIA
AAVASRALTVLWQREARYLNEDDRTAVRRRINAIVAGMRDSVLLEVPDLSPQHSELRAWAVSSTLTSLGRHSLSLPGEELKKLLYQACMAAARTPPVCEL
PPLPAGDAARDEADVLFSRYETLLAAGARLFRAQGYPAVNTSEIGKGAGIAGPGLYRSFSSKQAILDALIRRLDEWRCLECIRALRANQQAAQRLRGLVQ
GHVRISLDAPDLVAVSVTELSHASVEVRDGYLRNQGDREAVWIDLIGKLVPATSVAQGRLLVAAAISFIEDVARTWHLTRYAGVADEISGLALAILTSGA
GNLLRA

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.978000; 11 non-insertions in a row out of 18 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 18 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 18 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.441850; 6 non-insertions in a row out of 19 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.995700; 10 non-insertions in a row out of 19 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.13
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-) (Direct binding)
- Rv0047c (-) (Direct binding)
- Rv0081 (-) (Direct binding)
- Rv0324 (-) (Direct binding)
- Rv0602c (tcrA) (Direct binding)
- Rv1033c (trcR) (Direct binding)
- Rv1189 (sigI) (Direct binding)
- Rv1332 (-) (Direct binding)
- Rv1985c (-) (Direct binding)
- Rv2887 (-) (Direct binding)
- Rv3291c (lrpA) (Direct binding)
- Rv3488 (-) (Direct binding)
- Rv3574 (kstR) (Direct binding)
- Rv3597c (lsr2) (Direct binding)
- Rv3681c (whiB4) (Direct binding)
- Rv3765c (tcrX) (Direct binding)
- Rv3855 (ethR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
Upregulated by:
Downregulates:
- Rv0119 (fadD7)
- Rv1469 (ctpD)
Downregulated by:
- Rv0238 (-)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv1963c (mce3R)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv1973	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1973	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1973	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1973	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1972	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1972	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1972	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1972	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1970	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1970	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1970	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1970	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	sourish10	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	sourish10	IEP		Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1966	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	ahal4789	IEP		Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	ahal4789	IEP		Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1936	swatigandhi19	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1937	swatigandhi19	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1938	swatigandhi19	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1940	akankshajain.21	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1934c	ashwinigbhat	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1935c	harsharohiratruefriend	IEP		MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1933c	priti.priety	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1933c	ashwinigbhat	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1934c	priti.priety	IEP		Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1930c	swatigandhi19	IEP		Co-expression (Functional Linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1930c	swatigandhi19	IEP		Co-expression (Functional Linkage) authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr Revisiting the evolution of Mycobacterium bovis. J. Bacteriol. 2005
Interaction	Regulatory Rv1930c	swatigandhi19	IEP		Co-expression (Functional Linkage) authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol The 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Inhibition Rv0046c	shahanup86	IMP		MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulates Rv0234c	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1323	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv0046c	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1416	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1973	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1975	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1936	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1970	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1971	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1972	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1943c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1964	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1965	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1967	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1941	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1942c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1942c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1939	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1940	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1940	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1938	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1938	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1935c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1937	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
Interaction	Regulates Rv1938	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1933c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1934c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1935c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1930c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1931c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Citation	Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008	yamir.moreno	IEP	18304349	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1933c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv1973

ahal4789

IEP

Coexpression(Functional linkage)
S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004

Interaction

Regulatory Rv1973

ahal4789

IEP

Coexpression(Functional linkage)
S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005

Interaction

Regulatory Rv1973

sourish10

IEP

Interaction

Regulatory Rv1973

sourish10

IEP

Interaction

Regulatory Rv1972

ahal4789

IEP

Interaction

Regulatory Rv1972

ahal4789

IEP

Interaction

Regulatory Rv1972

sourish10

IEP

Interaction

Regulatory Rv1972

sourish10

IEP

Interaction

Regulatory Rv1971

sourish10

IEP

Interaction

Regulatory Rv1971

sourish10

IEP

Interaction

Regulatory Rv1971

ahal4789

IEP

Interaction

Regulatory Rv1970

ahal4789

IEP

Interaction

Regulatory Rv1970

sourish10

IEP

Interaction

Regulatory Rv1970

sourish10

IEP

Interaction

Regulatory Rv1971

ahal4789

IEP

Interaction

Regulatory Rv1969

sourish10

IEP

Interaction

Regulatory Rv1970

ahal4789

IEP

Interaction

Regulatory Rv1969

sourish10

IEP

Interaction

Regulatory Rv1969

ahal4789

IEP

Interaction

Regulatory Rv1969

ahal4789

IEP

Interaction

Regulatory Rv1968

sourish10

IEP

Interaction

Regulatory Rv1968

ahal4789

IEP

Interaction

Regulatory Rv1968

sourish10

IEP

Interaction

Regulatory Rv1968

ahal4789

IEP

Interaction

Regulatory Rv1967

sourish10

IEP

Interaction

Regulatory Rv1967

sourish10

IEP

Interaction

Regulatory Rv1967

ahal4789

IEP

Interaction

Regulatory Rv1966

sourish10

IEP

Interaction

Regulatory Rv1967

ahal4789

IEP

Interaction

Regulatory Rv1966

sourish10

IEP

Interaction

Regulatory Rv1966

sourish10

IEP

Coexpression(Functional linkage)
D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null

Interaction

Regulatory Rv1966

ahal4789

IEP

Interaction

Regulatory Rv1966

ahal4789

IEP

Interaction

Regulatory Rv1966

ahal4789

IEP

Interaction

Regulatory Rv1936

swatigandhi19

IEP

Co-expression (Functional linkage)
MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv1937

swatigandhi19

IEP

Interaction

Regulatory Rv1938

swatigandhi19

IEP

Interaction

Regulatory Rv1940

akankshajain.21

IEP

Interaction

Regulatory Rv1934c

ashwinigbhat

IEP

Interaction

Regulatory Rv1935c

harsharohiratruefriend

IEP

MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv1933c

priti.priety

IEP

Interaction

Regulatory Rv1933c

ashwinigbhat

IEP

Interaction

Regulatory Rv1934c

priti.priety

IEP

Interaction

Regulatory Rv1930c

swatigandhi19

IEP

Co-expression (Functional Linkage)
MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv1930c

swatigandhi19

IEP

Co-expression (Functional Linkage)
authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr Revisiting the evolution of Mycobacterium bovis. J. Bacteriol. 2005

Interaction

Regulatory Rv1930c

swatigandhi19

IEP

Co-expression (Functional Linkage)
authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol The 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. Proc. Natl. Acad. Sci. U.S.A. 2003

Interaction

Inhibition Rv0046c

shahanup86

IMP

Interaction

Regulates Rv0234c

yamir.moreno

IEP

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1323

yamir.moreno

IEP

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv0046c

yamir.moreno

IEP

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1416

yamir.moreno

IEP

Interaction

Regulates Rv1973

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1975

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1936

yamir.moreno

IEP

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1970

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1971

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1972

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1943c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1964

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1965

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1967

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1941

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1942c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1942c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1939

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1940

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1940

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1938

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1938

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1935c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1937

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.

Interaction

Regulates Rv1938

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1933c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1934c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1935c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1930c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1931c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Citation

Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008

yamir.moreno

IEP

18304349

Interaction

Regulates Rv1933c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

Comments