TB Genome Annotation Portal

Rv1963c (mce3R)

Amino Acid Sequence

MASVAQPVRRRPKDRKKQILDQAVGLFIERGFHSVKLEDIAEAAGVTARALYRHYDNKQALLAEAIRTGQDQYQSARRLTEGETEPTPRPLNADLEDLIA
AAVASRALTVLWQREARYLNEDDRTAVRRRINAIVAGMRDSVLLEVPDLSPQHSELRAWAVSSTLTSLGRHSLSLPGEELKKLLYQACMAAARTPPVCEL
PPLPAGDAARDEADVLFSRYETLLAAGARLFRAQGYPAVNTSEIGKGAGIAGPGLYRSFSSKQAILDALIRRLDEWRCLECIRALRANQQAAQRLRGLVQ
GHVRISLDAPDLVAVSVTELSHASVEVRDGYLRNQGDREAVWIDLIGKLVPATSVAQGRLLVAAAISFIEDVARTWHLTRYAGVADEISGLALAILTSGA
GNLLRA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1963c/mce3R, gene len: 1220 bp, num TA sites: 19
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathuncertainM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathYES (LFC=-2.85)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.992)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.41)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.39 (0.57)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv1963c/mce3RRv1963c/mce3R4.22
    Rv1963c/mce3RRv3260c/whiB21.41
    Rv1963c/mce3RRv0767c/-1.17
    Rv1963c/mce3RRv0238/fdmR-1.08


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1963c (mce3R)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv1973ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1973ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1973sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1973sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1972ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1972ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1972sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1972sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1971sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1971sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1971ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1970ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1970sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1970sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1971ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1969sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1970ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1969sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1969ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1969ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1968sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1968ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1968sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1968ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1967sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1967sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1967ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1966sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1967ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1966sourish10IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1966sourish10IEPCoexpression(Functional linkage)
    D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv1966ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
    InteractionRegulatory Rv1966ahal4789IEPCoexpression(Functional linkage)
    S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
    InteractionRegulatory Rv1966ahal4789IEPCoexpression(Functional linkage)
    D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv1936swatigandhi19IEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1937swatigandhi19IEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1938swatigandhi19IEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1940akankshajain.21IEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1934cashwinigbhatIEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1935charsharohiratruefriendIEP
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1933cpriti.prietyIEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1933cashwinigbhatIEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1934cpriti.prietyIEPCo-expression (Functional linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1930cswatigandhi19IEPCo-expression (Functional Linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulatory Rv1930cswatigandhi19IEPCo-expression (Functional Linkage)
    authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr Revisiting the evolution of Mycobacterium bovis. J. Bacteriol. 2005
    InteractionRegulatory Rv1930cswatigandhi19IEPCo-expression (Functional Linkage)
    authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol The 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. Proc. Natl. Acad. Sci. U.S.A. 2003
    InteractionInhibition Rv0046cshahanup86IMP
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    InteractionRegulates Rv0234cyamir.morenoIEPProteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1323yamir.morenoIEPProteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv0046cyamir.morenoIEPProteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1416yamir.morenoIEPProteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    InteractionRegulates Rv1973yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1975yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1936yamir.morenoIEPProteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1970yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1971yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1972yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1943cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1964yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1965yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1967yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1941yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1942cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1942cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1939yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1940yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1940yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1938yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1938yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1935cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1937yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    InteractionRegulates Rv1938yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1933cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1934cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1935cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1930cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    InteractionRegulates Rv1931cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
    CitationStudy of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. MP. Santangelo, FC. Blanco et al. BMC Microbiol. 2008yamir.morenoIEP18304349Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    InteractionRegulates Rv1933cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

    Comments