Rv1917c (PPE34)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: PPE family protein
- PATRIC: PPE family protein
- TUBERCULIST: PPE family protein PPE34
- NCBI: PPE family protein PPE34
- updated information (H37Rv4):
  - gene name: PPE34
  - function:
  - reference:
Type: Essential
Start: 2162932
End: 2167311
Operon:

Trans-membrane region:
Role: IV.C.2 - PPE family
GO terms:
- GO:0052553 - modulation by symbiont of host immune response (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009986 - cell surface (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
5XFS	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
6VHR	41%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group I422
6UUJ	41%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121

Links to additional information on PPE34:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.996 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MNFSTLPPEINSALIFGGAGSEPMSAAAVAWDQLAMELASAAASFNSVTSGLVGESWLGPSSAAMAAAVAPYLGWLAAAAAQAQRSATQAAALVAEFEAV
RAAMVQPALVAANRSDLVSLVFSNFFGQNAPAIAAIEAAYEQMWAIDVSVMSAYHAGASAVASALTPFTAPPQNLTDLPAQLAAAPAAVVTAAITSSKGV
LANLSLGLANSGFGQMGAANLGILNLGSLNPGGNNFGLGNVGSNNVGLGNTGNGNIGFGNTGNGNIGFGLTGDNQQGFGGWNSGTGNIGLFNSGTGNIGI
GNTGTGNFGIGNSGTSYNTGIGNTGQANTGFFNAGIANTGIGNTGNYNTGSFNLGSFNTGDFNTGSSNTGFFNPGNLNTGVGNTGNVNTGGFNSGNYSNG
FFWRGDYQGLIGFSGTLTIPAAGLDLNGLGSVGPITIPSITIPEIGLGINSSGALVGPINVPPITVPAIGLGINSTGALVGPINIPPITLNSIGLELSAF
QVINVGSISIPASPLAIGLFGVNPTVGSIGPGSISIQLGTPEIPAIPPFFPGFPPDYVTVSGQIGPITFLSGGYSLPAIPLGIDVGGGLGPFTVFPDGYS
LPAIPLGIDVGGGLGPFTVFPDGYSLPAIPLGIDVGGGLGPFTVFPDGYSLPAIPLGIDVGGAIGPLTTPPITIPSIPLGIDVSGSLGPINIPIEIAGTP
GFGNSTTTPSSGFFNSGTGGTSGFGNVGSGGSGFWNIAGNLGNSGFLNVGPLTSGILNFGNTVSGLYNTSTLGLATSAFHSGVGNTDSQLAGFMRNAAGG
TLFNFGFANDGTLNLGNANLGDYNVGSGNVGSYNFGSGNIGNGSFGFGNIGSNNFGFGNVGSNNLGFANTGPGLTEALHNIGFGNIGGNNYGFANIGNGN
IGFGNTGTGNIGIGLTGDNQVGFGALNSGSGNIGFFNSGNGNIGFFNSGNGNVGIGNSGNYNTGLGNVGNANTGLFNTGNVNTGIGNAGSYNTGSYNAGD
TNTGDLNPGNANTGYLNLGDLNTGWGNIGDLNTGALISGSYSNGILWRGDYQGLIGYSDTLSIPAIPLSVEVNGGIGPIVVPDITIPGIPLSLNALGGVG
PIVVPDITIPGIPLSLNALGGVGPIVVPDITIPGIPLSLNALGGVGPIVVPDITIPGIPLSLNALGGVGPIVVPDITIPGIPLSLNALGGVGPITVPGVP
ISRIPLTINIRIPVNITLNELPFNVAGIFTGYIGPIPLSTFVLGVTLAGGTLESGIQGFSVNPFGLNIPLSGATNAVTIPGFAINPFGLNVPLSGGTSPV
TIPGFAINPFGLNVPLSGGTSPVTIPGFTIPGSPLNLTANGGLGPINIPINITSAPGFGNSTTTPSSGFFNSGDGSASGFGNVGPGISGLWNQVPNALQG
GVSGIYNVGQLASGVANLGNTVSGFNNTSTVGHLTAAFNSGVNNIGQMLLGFFSPGAGP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000100; 11 non-insertions in a row out of 121 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 121 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 8 non-insertions in a row out of 121 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.998550; 15 non-insertions in a row out of 106 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.992900; 14 non-insertions in a row out of 106 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.46
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3249c (-)
- Rv3286c (sigF)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv3249c (-)
- Rv3286c (sigF)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Expression, characterization and subcellular localization of the Mycobacterium tuberculosis PPE gene Rv1917c. SL. Sampson, P. Lukey et al. Tuberculosis (Edinburgh, Scotland) 2001	kaveri.verma	ISA	11800581	Co-expression (Functional Linkage)
Interaction	Transcription Rv1918c	kaveri.verma	ISA		Co-expression (Functional Linkage) SL. Sampson, P. Lukey et al. Expression, characterization and subcellular localization of the Mycobacterium tuberculosis PPE gene Rv1917c. Tuberculosis (Edinburgh, Scotland) 2001
Interaction	Transcription Rv1918c	kaveri.verma	ISA		Co-expression (Functional Linkage) SL. Sampson, P. Lukey et al. Expression, characterization and subcellular localization of the Mycobacterium tuberculosis PPE gene Rv1917c. Tuberculosis (Edinburgh, Scotland) 2001
Citation	Src homology 3-interacting domain of Rv1917c of Mycobacterium tuberculosis induces selective maturation of human dendritic cells by regulating PI3K-MAPK-NF-kappaB signaling and drives Th2 immune responses. authors,K. Bansal,AY. Sinha,DS. Ghorpade,SK. Togarsimalemath,SA. Patil,SV. Kaveri,KN. Balaji,J. Bayry J. Biol. Chem. 2010	jlew		20837474	We demonstrate that Rv1917c (PPE34) interacts with TLR2 and triggers functional maturation of human DCs.

TB Genome Annotation Portal