Rv1916 (aceAb)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: isocitrate lyase
REFSEQ: isocitrate lyase
PATRIC: Isocitrate lyase (EC 4.1.3.1) group III Mycobacterial type ICL2
TUBERCULIST: Probable isocitrate lyase AceAb [second part] (isocitrase) (isocitratase) (Icl)
NCBI: Probable isocitrate lyase AceAb [second part] (isocitrase) (isocitratase) (Icl)
updated information (H37Rv4):
gene name: aceAb
function:
reference:
Coordinates in H37Rv: 2161566 - 2162762
Gene length: 1197 bp (with stop codon), 398 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.B.4 - Glyoxylate bypass
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 8G8K 100% Mycobacterium tuberculosis H37Rv Crystal structure of Rv1916 (residues 233-398) 6EE1 100% Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA 6EDZ 100% Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA, form I 6EDW 100% Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Crystal structure of Mycobacterium tuberculosis ICL2 in the apo form 9OBO 99% Mycobacterium tuberculosis CDC1551 Crystal structure of Mycobacterium tuberculosis isocitrate lyase 2 fixed in the apo form with disulfide bonds 3LG3 48% Yersinia pestis 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92 7RB1 47% Mycobacterium tuberculosis Isocitrate Lyase-1 from Mycobacterium tuberculosis covalently modified by 5-descarboxy-5-nitro-D-isocitric acid 7CP1 47% Mycobacterium tuberculosis H37Rv Crystal structure of isocitrate lyase in complex with succinate and itaconate 6XPP 47% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of itaconate modified Mycobaterium tuberculosis isocitrate lyase 6WSI 47% Mycobacterium tuberculosis Intact cis-2,3-epoxysuccinic acid bound to Isocitrate Lyase-1 from Mycobacterium tuberculosis
Links to additional information on aceAb:
Amino Acid Sequence
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADA
RQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTL
VGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGR
TILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1916/aceAb,
gene len: 1196 bp, num TA sites: 18
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro no data 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.33) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-0.051) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.4) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1916: 0.819774077
lineage-specific pN/pS in L1: 0.751138342
lineage-specific pN/pS in L2: 0.851542711
lineage-specific pN/pS in L3: 0.864554399
lineage-specific pN/pS in L4: 0.833229964
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.78 (0.83)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Term TBRXN:ICL Isocitrate lyase - IDA njamshidi IDA 10932251 PMID: 10932251V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Citation Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. V. Sharma, S. Sharma et al. Nat. Struct. Biol. 2000 njamshidi ISS 10932251 PMID: 10932251
Term EC:4.1.3.1 Isocitrate lyase. - ISS njamshidi ISS 10932251 PMID: 10932251V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Term TBRXN:ICL Isocitrate lyase - ISS njamshidi ISS 10932251 PMID: 10932251V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Citation Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. V. Sharma, S. Sharma et al. Nat. Struct. Biol. 2000 njamshidi IDA 10932251 PMID: 10932251
Term EC:4.1.3.1 Isocitrate lyase. - IDA njamshidi IDA 10932251 PMID: 10932251V. Sharma, S. Sharma et al. Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat. Struct. Biol. 2000
Interaction RegulatedBy Rv3286c yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011 extern:JZUCKER 21561773 Traceable author statement to experimental support
Term EC:4.1.3.30 Methylisocitrate lyase. - NR extern:JZUCKER NR Traceable author statement to experimental supportauthors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term EC:4.1.3.1 Isocitrate lyase. - NR extern:JZUCKER NR Traceable author statement to experimental supportauthors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Citation Characterization of activity and expression of isocitrate lyase in Mycobacterium avium and Mycobacterium tuberculosis. K. Hner Zu Bentrup, A. Miczak et al. J. Bacteriol. 1999 extern:JZUCKER 10572116 Inferred from mutant phenotype
Term EC:4.1.3.30 Methylisocitrate lyase. - NR extern:JZUCKER NR Inferred from mutant phenotypeK. Hner Zu Bentrup, A. Miczak et al. Characterization of activity and expression of isocitrate lyase in Mycobacterium avium and Mycobacterium tuberculosis. J. Bacteriol. 1999
Term EC:4.1.3.1 Isocitrate lyase. - NR extern:JZUCKER NR Inferred from mutant phenotypeK. Hner Zu Bentrup, A. Miczak et al. Characterization of activity and expression of isocitrate lyase in Mycobacterium avium and Mycobacterium tuberculosis. J. Bacteriol. 1999