TB Genome Annotation Portal

Rv1915 (aceAa)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: isocitrate lyase
  • REFSEQ: isocitrate lyase
  • PATRIC: Isocitrate lyase (EC 4.1.3.1) group III Mycobacterial type ICL2
  • TUBERCULIST: Probable isocitrate lyase AceAa [first part] (isocitrase) (isocitratase) (Icl)
  • NCBI: Probable isocitrate lyase AceAa [first part] (isocitrase) (isocitratase) (Icl)
  • updated information (H37Rv4):
    • gene name: aceAa
    • function:
    • reference:
• Type: Not Target
• Start: 2160463
• End: 2161566
• Operon:


• Trans-membrane region:
  
• Role: I.B.4 - Glyoxylate bypass
• GO terms:
  • GO:0046421 - methylisocitrate lyase activity (Uniprot)
  • GO:0019752 - carboxylic acid metabolic process (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006102 - isocitrate metabolic process (Uniprot)
  • GO:0006097 - glyoxylate cycle (Uniprot)
  • GO:0004451 - isocitrate lyase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6EE1	99%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA
  6EDZ	99%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	Crystal structure of Mycobacterium tuberculosis ICL2 in complex with acetyl-CoA, form I
  6EDW	99%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	Crystal structure of Mycobacterium tuberculosis ICL2 in the apo form
  5E9H	42%	Gibberella zeae PH-1	Structural insights of isocitrate lyases from Fusarium graminearum
  5E9G	41%	Magnaporthe oryzae 70-15	Structural insights of isocitrate lyases from Magnaporthe oryzae
  5E9F	41%	Magnaporthe oryzae 70-15	Structural insights of isocitrate lyases from Magnaporthe oryzae
  1DQU	41%	Emericella nidulans	CRYSTAL STRUCTURE OF THE ISOCITRATE LYASE FROM ASPERGILLUS NIDULANS
  3P0X	39%	Brucella melitensis biovar Abortus	Crystal structure of isocitrate lyase from Brucella melitensis, bound to magnesium isocitrate
  3OQ8	39%	Brucella melitensis biovar Abortus	Crystal structure of isocitrate lyase from Brucella melitensis, bound to the product mimic malonate
  3E5B	39%	Brucella abortus	2.4 A crystal structure of isocitrate lyase from brucella melitensis

• Links to additional information on aceAa:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.623 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVAREAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGI
EAIYLGGWATSAKGSSTEDPGPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADAGTGHGGDPHVRNLIRRFVEVGV
PGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQLDIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFTNWAS
RSSMVIFSMRLATASTRRPAVGLSAKAFSAWSPTRSTRGGRTASSRSTAFSTRSSRGSWRPGRTTRA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.64 (0.67)	1.78 (0.86)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link