TB Genome Annotation Portal

Rv1908c (katG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: catalase-peroxidase
  • REFSEQ: catalase-peroxidase-peroxynitritase T KATG
  • PATRIC: Catalase (EC 1.11.1.6) / Peroxidase (EC 1.11.1.7)
  • TUBERCULIST: Catalase-peroxidase-peroxynitritase T KatG
  • NCBI: Catalase-peroxidase-peroxynitritase T KatG
  • updated information (H37Rv4):
    • gene name: katG
    • function:
    • reference:
• Type: Not Target
• Start: 2153889
• End: 2156111
• Operon:


• Trans-membrane region:
  
• Role: III.F - Detoxification
• GO terms:
  • GO:0098869 - cellular oxidant detoxification (Uniprot)
  • GO:0070404 - NADH binding (Uniprot)
  • GO:0070402 - NADPH binding (Uniprot)
  • GO:0070301 - cellular response to hydrogen peroxide (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0052059 - evasion or tolerance by symbiont of host-produced reactive oxygen species (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0045739 - positive regulation of DNA repair (Uniprot)
  • GO:0042744 - hydrogen peroxide catabolic process (Uniprot)
  • GO:0020037 - heme binding (Uniprot)
  • GO:0016677 - oxidoreductase activity, acting on a heme group of donors, nitrogenous group as acceptor (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0006979 - response to oxidative stress (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004601 - peroxidase activity (Uniprot)
  • GO:0004096 - catalase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 2 H2O2[c] -> O2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2ccd, 2cca, 1sj2
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1SJ2	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis catalase-peroxidase
  2CCA	99%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis
  4C51	99%	MYCOBACTERIUM TUBERCULOSIS H37RV	Crystal Structure of the Catalase-Peroxidase (KatG) R418L mutant from Mycobacterium Tuberculosis
  4C50	99%	MYCOBACTERIUM TUBERCULOSIS	Crystal Structure of the Catalase-Peroxidase (KatG) D137S mutant from Mycobacterium Tuberculosis
  2CCD	99%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis
  6MQ1	67%	Burkholderia pseudomallei	B. pseudomallei KatG crystalized in the presence of ABTS
  6MQ0	67%	Burkholderia pseudomallei	B. pseudomallei KatG crystallized in the presence of furoyl hydrazide
  6MPY	67%	Burkholderia pseudomallei	B. pseudomallei KatG crystallized in the presence of benzoyl hydrazide
  5SYL	67%	Burkholderia pseudomallei (strain 1710b)	B. pseudomallei KatG with KCN bound
  5SXX	67%	Burkholderia pseudomallei (strain 1710b)	Crystal structure of the E198A variant of Burkholderia pseudomallei catalase-peroxidase KatG with INH

• Links to additional information on katG:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.963 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGP
LFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGK
EATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEH
PEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQ
PQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGS
NSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR

Additional Information