TB Genome Annotation Portal

Rv1908c (katG)

Amino Acid Sequence

VPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGP
LFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGK
EATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEH
PEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQ
PQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGS
NSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1908c/katG, gene len: 2222 bp, num TA sites: 39
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysgrowth defectminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=2.85)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.82 (0.98)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv1908c/katGRv1909c/furA-2.74
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1908c (katG)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:SPODM superoxide dismutase - ISSnjamshidiISSKatG is a bifunctional enzyme . PMID 15840564
    RA. Ghiladi, GM. Knudsen et al. The Met-Tyr-Trp cross-link in Mycobacterium tuberculosis catalase-peroxidase (KatG): autocatalytic formation and effect on enzyme catalysis and spectroscopic properties. J. Biol. Chem. 2005
    CitationThe Met-Tyr-Trp cross-link in Mycobacterium tuberculosis catalase-peroxidase (KatG): autocatalytic formation and effect on enzyme catalysis and spectroscopic properties. RA. Ghiladi, GM. Knudsen et al. J. Biol. Chem. 2005njamshidiISS15840564KatG is a bifunctional enzyme . PMID 15840564
    TermEC:1.15.1.1 Superoxide dismutase. - ISSnjamshidiISSKatG is a bifunctional enzyme . PMID 15840564
    RA. Ghiladi, GM. Knudsen et al. The Met-Tyr-Trp cross-link in Mycobacterium tuberculosis catalase-peroxidase (KatG): autocatalytic formation and effect on enzyme catalysis and spectroscopic properties. J. Biol. Chem. 2005
    CitationGrowth of mycobacteria on carbon monoxide and methanol. authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim J. Bacteriol. 2003njamshidiISS12486050added during gap filling; peroxidase activity of multiple substrates has been associated based on sequence (verfified again by SEED), methanol metabolism has been demonstrated in literature (PMID 12486050)
    TermEC:1.11.1.7 Peroxidase. - ISSnjamshidiISSadded during gap filling; peroxidase activity of multiple substrates has been associated based on sequence (verfified again by SEED), methanol metabolism has been demonstrated in literature (PMID 12486050)
    authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
    TermTBRXN:PRDX Peroxidase (multiple substrates) - ISSnjamshidiISSadded during gap filling; peroxidase activity of multiple substrates has been associated based on sequence (verfified again by SEED), methanol metabolism has been demonstrated in literature (PMID 12486050)
    authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
    TermTBRXN:CAT catalase - ISSnjamshidiISS15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown Crystal structure of Mycobacterium tuberculosis catalase-peroxidase. J. Biol. Chem. 2004
    CitationProbing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Dalton Trans 2005njamshidiISS15231843|16315359PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    TermEC:1.11.1.6 Catalase. - ISSnjamshidiISS15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Probing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. Dalton Trans 2005
    TermTBRXN:CAT catalase - ISSnjamshidiISS15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Probing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. Dalton Trans 2005
    CitationCrystal structure of Mycobacterium tuberculosis catalase-peroxidase. authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown J. Biol. Chem. 2004njamshidiIDA15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    TermEC:1.11.1.6 Catalase. - IDAnjamshidiIDA15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown Crystal structure of Mycobacterium tuberculosis catalase-peroxidase. J. Biol. Chem. 2004
    TermTBRXN:CAT catalase - IDAnjamshidiIDA15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown Crystal structure of Mycobacterium tuberculosis catalase-peroxidase. J. Biol. Chem. 2004
    CitationProbing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Dalton Trans 2005njamshidiIDA15231843|16315359PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    TermEC:1.11.1.6 Catalase. - IDAnjamshidiIDA15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Probing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. Dalton Trans 2005
    TermTBRXN:CAT catalase - IDAnjamshidiIDA15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,NA. Eady,NA. Jesmin,S. Servos,AE. Cass,JM. Nagy,KA. Brown Probing the function of Mycobacterium tuberculosis catalase-peroxidase by site-directed mutagenesis. Dalton Trans 2005
    CitationCrystal structure of Mycobacterium tuberculosis catalase-peroxidase. authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown J. Biol. Chem. 2004njamshidiISS15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    TermEC:1.11.1.6 Catalase. - ISSnjamshidiISS15231843PMID: 15231843. the catalase activity is more crucial to its survival than the peroxidase activity PMID: 16315359
    authors,T. Bertrand,NA. Eady,JN. Jones,null. Jesmin,JM. Nagy,B. Jamart-Grgoire,EL. Raven,KA. Brown Crystal structure of Mycobacterium tuberculosis catalase-peroxidase. J. Biol. Chem. 2004
    InteractionTranscription Rv1909ckaveri.vermaIMPMutation studies
    AS. Pym, P. Domenech et al. Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis. Mol. Microbiol. 2001
    InteractionRegulatory Rv0117shahanup86IEPCo-expression (Functional linkage)
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3416yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2034yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0117yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0117yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0117yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006

    Comments