Rv1886c (fbpB)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: antigen 85-B
REFSEQ: secreted antigen 85-B fbpB (85B) (antigen 85 complex B) (Mycolyl transferase 85B) (fibronectin-binding protein B) (extracellular alpha-antigen)
PATRIC: Esterase secreted fibronectin-binding protein antigen 85-B FbpB
TUBERCULIST: Secreted antigen 85-B FbpB (85B) (antigen 85 complex B) (mycolyl transferase 85B) (fibronectin-binding protein B) (extracellular alpha-antigen)
NCBI: Secreted antigen 85-B FbpB (85B) (antigen 85 complex B) (mycolyl transferase 85B) (fibronectin-binding protein B) (extracellular alpha-antigen)
updated information (H37Rv4):
gene name: fbpB
function:
reference:
Coordinates in H37Rv: 2134890 - 2135867
Gene length: 978 bp (with stop codon), 325 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.H.3 - Acyltransferases, Mycoloyltransferases, and phospholipid synthesis
GO terms:
GO:0052572 - response to host immune response (Uniprot)
GO:0050348 - trehalose O-mycolyltransferase activity (Uniprot)
GO:0046677 - response to antibiotic (Uniprot)
GO:0044119 - growth of symbiont in host cell (Uniprot)
GO:0044044 - interaction with host via substance in symbiont surface (Uniprot)
GO:0040007 - growth (Uniprot)
GO:0035375 - zymogen binding (Uniprot)
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups (Uniprot)
GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
GO:0016740 - transferase activity (Uniprot)
GO:0010756 - positive regulation of plasminogen activation (Uniprot)
GO:0005886 - plasma membrane (Uniprot)
GO:0005618 - cell wall (Uniprot)
GO:0005576 - extracellular region (Uniprot)
GO:0005515 - protein binding (Uniprot)
GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
GO:0001968 - fibronectin binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 1f0n , 1f0p
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 1F0P 100% Mycobacterium tuberculosis MYCOBACTERIUM TUBERCULOSIS ANTIGEN 85B WITH TREHALOSE 1F0N 100% Mycobacterium tuberculosis MYCOBACTERIUM TUBERCULOSIS ANTIGEN 85B 1SFR 82% Mycobacterium tuberculosis Crystal Structure of the Mycobacterium tuberculosis Antigen 85A Protein 4QDT 72% Mycobacterium tuberculosis Crystal structure of Antigen 85C co-crystallized with iodoacetamide 4MQM 72% Mycobacterium tuberculosis Crystal structure of Antigen 85C in presence of Ebselen 5VNS 72% Mycobacterium tuberculosis M.tb Antigen 85C Acyl-Enzyme Intermediate with Tetrahydrolipstatin 5OCJ 72% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of Ag85C bound to cyclophostin 8beta inhibitor 5KWJ 72% Mycobacterium tuberculosis M.tb Ag85C modified at C209 by amino-ebselen 5KWI 72% Mycobacterium tuberculosis M.tb Ag85C modified at C209 by adamantyl-ebselen 3HRH 72% Mycobacterium tuberculosis Crystal Structure of Antigen 85C and Glycerol
Links to additional information on fbpB:
Amino Acid Sequence
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG
THSWEYWGAQLNAMKGDLQSSLGAG
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1886c/fbpB,
gene len: 977 bp, num TA sites: 25
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio growth advantage 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.79) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.176) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.81) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1886c: 0.698909799
lineage-specific pN/pS in L1: 0.607328515
lineage-specific pN/pS in L2: 0.705175887
lineage-specific pN/pS in L3: 0.816519448
lineage-specific pN/pS in L4: 0.72108211
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.67 (0.62)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction PhysicalInteraction Rv1911c kaveri.verma IDA In vitro transposition reactionsM. Braunstein,IV. Griffin TJ,JI. Kriakov,ST. Friedman,ND. Grindley,WR. Jacobs Identification of genes encoding exported Mycobacterium tuberculosis proteins using a Tn552'phoA in vitro transposition system. J. Bacteriol. 2000
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI structural analysisauthors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI structural analysisK. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI structural analysisauthors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI structural analysisauthors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI Spectrophometric assayauthors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI Spectrophometric assayK. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI structural analysisauthors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI Spectrophometric assayauthors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI Spectrophometric assayauthors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction PhysicalInteraction Rv0129c prabhakarsmail IPI Spectrophometric assayauthors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction RegulatedBy Rv0348 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction RegulatedBy Rv1221 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name mycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATION mjackson IMP Mycolic acid processing
Name mycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATION mjackson IDA Mycolic acid processing
Citation Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001 jjmcfadden 11555614 Inferred from direct assay
Term EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR jjmcfadden NR Inferred from direct assayauthors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. V. Puech, C. Guilhot et al. Mol. Microbiol. 2002 extern:JZUCKER 12010501 Inferred from mutant phenotype
Term EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR extern:JZUCKER NR Inferred from mutant phenotypeV. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR extern:JZUCKER NR Inferred from mutant phenotypeV. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Citation Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Science 1997 extern:JZUCKER 9162010 Assay of protein purified to homogeneity from its native host
Term EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR extern:JZUCKER NR Assay of protein purified to homogeneity from its native hostauthors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR extern:JZUCKER NR Assay of protein purified to homogeneity from its native hostauthors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997