TB Genome Annotation Portal

Rv1886c (fbpB)

Amino Acid Sequence

MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG
THSWEYWGAQLNAMKGDLQSSLGAG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1886c/fbpB, gene len: 977 bp, num TA sites: 25
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth advantage7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.79)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.176)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.81)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.67 (0.62)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    RNA processing and modification
    Energy production and conversion
    Chromatin structure and dynamics
    Amino acid transport and metabolism
    Cell cycle control, cell division, chromosome partitioning
    Carbohydrate transport and metabolism
    Nucleotide transport and metabolism
    Lipid transport and metabolism
    Coenzyme transport and metabolism
    Transcription
    Translation, ribosomal structure and biogenesis
    Cell wall/membrane/envelope biogenesis
    Replication, recombination and repair
    Posttranslational modification, protein turnover, chaperones
    Cell motility
    Secondary metabolites biosynthesis, transport and catabolism
    Inorganic ion transport and metabolism
    Function unknown
    General function prediction only
    Intracellular trafficking, secretion, and vesicular transport
    Signal transduction mechanisms
    Extracellular structures
    Defense mechanisms
    Nuclear structure
    Cytoskeleton
  • BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
  • Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
  • BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)
  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    no significant interactions found



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1886c (fbpB)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv1911ckaveri.vermaIDAIn vitro transposition reactions
    M. Braunstein,IV. Griffin TJ,JI. Kriakov,ST. Friedman,ND. Grindley,WR. Jacobs Identification of genes encoding exported Mycobacterium tuberculosis proteins using a Tn552'phoA in vitro transposition system. J. Bacteriol. 2000
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPIstructural analysis
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPIstructural analysis
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPIstructural analysis
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPIstructural analysis
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPISpectrophometric assay
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPISpectrophometric assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPIstructural analysis
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPISpectrophometric assay
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPISpectrophometric assay
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    InteractionPhysicalInteraction Rv0129cprabhakarsmailIPISpectrophometric assay
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    Namemycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATIONmjacksonIMPMycolic acid processing
    Namemycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATIONmjacksonIDAMycolic acid processing
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001jjmcfadden11555614Inferred from direct assay
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRjjmcfaddenNRInferred from direct assay
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    CitationEvidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. V. Puech, C. Guilhot et al. Mol. Microbiol. 2002extern:JZUCKER12010501Inferred from mutant phenotype
    TermEC:2.3.1.122 Trehalose O-mycolyltransferase. - NRextern:JZUCKERNRInferred from mutant phenotype
    V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRInferred from mutant phenotype
    V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
    CitationRole of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Science 1997extern:JZUCKER9162010Assay of protein purified to homogeneity from its native host
    TermEC:2.3.1.122 Trehalose O-mycolyltransferase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997

    Comments