TB Genome Annotation Portal

Rv1832 (gcvB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: glycine dehydrogenase [decarboxylating]
  • REFSEQ: glycine dehydrogenase
  • PATRIC: Glycine dehydrogenase [decarboxylating] (glycine cleavage system P protein) (EC 1.4.4.2)
  • TUBERCULIST: Probable glycine dehydrogenase GcvB (glycine decarboxylase) (glycine cleavage system P-protein)
  • NCBI: Probable glycine dehydrogenase GcvB (glycine decarboxylase) (glycine cleavage system P-protein)
  • updated information (H37Rv4):
    • gene name: gcvB
    • function:
    • reference:
• Type: Not Target
• Start: 2075877
• End: 2078702
• Operon:


• Trans-membrane region:
  
• Role: I.C.1 - General
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0006546 - glycine catabolic process (Uniprot)
  • GO:0006544 - glycine metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0004375 - glycine dehydrogenase (decarboxylating) activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GLY[c] + LIPOYLPROTEIN[c] -> CO2[c] + SAP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4LHD	54%	Synechocystis sp.	Crystal structure of Synechocystis sp. PCC 6803 glycine decarboxylase (P-protein), holo form with pyridoxal-5'-phosphate and glycine, closed flexible loop
  4LHC	54%	Synechocystis sp.	Crystal structure of Synechocystis sp. PCC 6803 glycine decarboxylase (P-protein), holo form with pyridoxal-5'-phosphate and glycine
  4LGL	54%	Synechocystis sp.	Crystal Structure of Glycine Decarboxylase P-protein from Synechocystis sp. PCC 6803, apo form
  6I35	50%	Homo sapiens	Crystal structure of human glycine decarboxylase (P-protein) bound with pyridoxyl-glycine-5'-monophosphate
  6I34	50%	Homo sapiens neanderthalensis	Crystal structure of Neanderthal glycine decarboxylase (P-protein)
  6I33	50%	Homo sapiens	Crystal structure of human glycine decarboxylase (P-protein)
  1WYV	42%	Thermus thermophilus	Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in inhibitor-bound form
  1WYU	42%	Thermus thermophilus	Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in holo form
  1WYT	42%	Thermus thermophilus	Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in apo form
  1WYV	41%	Thermus thermophilus	Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in inhibitor-bound form

• Links to additional information on gcvB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -3.785 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • Photo of spot titer

Amino Acid Sequence

VSDHSTFADRHIGLDSQAVATMLAVIGVDSLDDLAVKAVPAGILDTLTDTGAAPGLDSLPPAASEAEALAELRALADANTVAVSMIGQGYYDTHTPPVLL
RNIIENPAWYTAYTPYQPEISQGRLEALLNFQTLVTDLTGLEIANASMLDEGTAAAEAMTLMHRAARGPVKRVVVDADVFTQTAAVLATRAKPLGIEIVT
ADLRAGLPDGEFFGVIAQLPGASGRITDWSALVQQAHDRGALVAVGADLLALTLIAPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAKHARQLPGR
LVGVSVDSDGTPAYRLALQTREQHIRRDKATSNICTAQVLLAVLAAMYASYHGAGGLTAIARRVHAHAEAIAGALGDALVHDKYFDTVLARVPGRADEVL
ARAKANGINLWRVDADHVSVACDEATTDTHVAVVLDAFGVAAAAPAHTDIATRTSEFLTHPAFTQYRTETSMMRYLRALADKDIALDRSMIPLGSCTMKL
NAAAEMESITWPEFGRQHPFAPASDTAGLRQLVADLQSWLVLITGYDAVSLQPNAGSQGEYAGLLAIHEYHASRGEPHRDICLIPSSAHGTNAASAALAG
MRVVVVDCHDNGDVDLDDLRAKVGEHAERLSALMITYPSTHGVYEHDIAEICAAVHDAGGQVYVDGANLNALVGLARPGKFGGDVSHLNLHKTFCIPHGG
GGPGVGPVAVRAHLAPFLPGHPFAPELPKGYPVSSAPYGSASILPITWAYIRMMGAEGLRAASLTAITSANYIARRLDEYYPVLYTGENGMVAHECILDL
RGITKLTGITVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESESLAEVDAFCEAMIGIRAEIDKVGAGEWPVDDNPLRGAPHTAQCLLASDWDHPYTRE
QAAYPLGTAFRPKVWPAVRRIDGAYGDRNLVCSCPPVEAFA

Additional Information