TB Genome Annotation Portal

Rv1826 (gcvH)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: glycine cleavage system H protein
  • REFSEQ: glycine cleavage system protein H
  • PATRIC: Glycine cleavage system H protein
  • TUBERCULIST: Probable glycine cleavage system H protein GcvH
  • NCBI: Probable glycine cleavage system H protein GcvH
  • updated information (H37Rv4):
    • gene name: gcvH
    • function:
    • reference:
• Type: Not Target
• Start: 2071952
• End: 2072356
• Operon:


• Trans-membrane region:
  
• Role: I.C.1 - General
• GO terms:
  • GO:0019464 - glycine decarboxylation via glycine cleavage system (Uniprot)
  • GO:0005960 - glycine cleavage complex (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NAD[c] + THF[c] + GLY[c] -> H[c] + NADH[c] + CO2[c] + METTHF[c] + NH3[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3ift, 3hgb
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3IFT	100%	Mycobacterium tuberculosis	Crystal structure of glycine cleavage system protein H from Mycobacterium tuberculosis, using X-rays from the Compact Light Source.
  3HGB	99%	Mycobacterium tuberculosis	Crystal structure of glycine cleavage system protein H from Mycobacterium tuberculosis
  1ONL	51%	Thermus thermophilus	Crystal structure of Thermus thermophilus HB8 H-protein of the glycine cleavage system
  3TZU	50%	Mycobacterium marinum	Crystal structure of a glycine cleavage system H protein (GCVH) from Mycobacterium marinum
  3A7L	48%	Escherichia coli	Crystal structure of E. coli apoH-protein
  3A7A	48%	Escherichia coli	Crystal structure of E. coli lipoate-protein ligase A in complex with octyl-amp and apoH-protein
  3AB9	47%	Escherichia coli	Crystal Structure of lipoylated E. coli H-protein (reduced form)
  3A8K	47%	Escherichia coli	Crystal Structure of ETD97N-EHred complex
  3A8J	47%	Escherichia coli	Crystal Structure of ET-EHred complex
  3A8I	47%	Escherichia coli	Crystal Structure of ET-EHred-5-CH3-THF complex

• Links to additional information on gcvH:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -4.279 (from Jeremy Rock's lab)

Amino Acid Sequence

VSDIPSDLHYTAEHEWIRRSGDDTVRVGITDYAQSALGDVVFVQLPVIGTAVTAGETFGEVESTKSVSDLYAPISGKVSEVNSDLDGTPQLVNSDPYGAG
WLLDIQVDSSDVAALESALTTLLDAEAYRGTLTE

Additional Information