TB Genome Annotation Portal

Rv1818c (PE_PGRS33)

Amino Acid Sequence

MSFVVTIPEALAAVATDLAGIGSTIGTANAAAAVPTTTVLAAAADEVSAAMAALFSGHAQAYQALSAQAALFHEQFVRALTAGAGSYAAAEAASAAPLEG
VLDVINAPALALLGRPLIGNGANGAPGTGANGGDGGILIGNGGAGGSGAAGMPGGNGGAAGLFGNGGAGGAGGNVASGTAGFGGAGGAGGLLYGAGGAGG
AGGRAGGGVGGIGGAGGAGGNGGLLFGAGGAGGVGGLAADAGDGGAGGDGGLFFGVGGAGGAGGTGTNVTGGAGGAGGNGGLLFGAGGVGGVGGDGVAFL
GTAPGGPGGAGGAGGLFGVGGAGGAGGIGLVGNGGAGGSGGSALLWGDGGAGGAGGVGSTTGGAGGAGGNAGLLVGAGGAGGAGALGGGATGVGGAGGNG
GTAGLLFGAGGAGGFGFGGAGGAGGLGGKAGLIGDGGDGGAGGNGTGAKGGDGGAGGGAILVGNGGNGGNAGSGTPNGSAGTGGAGGLLGKNGMNGLP
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.56 (0.48)1.41 (0.73)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 16 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 16 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 16 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.062500;
3 non-insertions in a row out of 17 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 17 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.93
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1818c (PE_PGRS33)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2250csourish10IPIYeast two-hybrid (Physical interaction)
    J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
    InteractionRegulatedBy Rv2710yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
    CitationFunctional dissection of the PE domain responsible for translocation of PE_PGRS33 across the mycobacterial cell wall. authors,A. Cascioferro,MH. Daleke,M. Ventura,V. Don,G. Delogu,G. Pal,W. Bitter,R. Manganelli PLoS ONE 2011jlew22110736In this paper, we characterize the PE domain of PE_PGRS33 (PERv1818c), one of the best characterized PE proteins. We confirmed that the PE domain is essential for PE_PGRS33 surface localization. Using Mycobacterium marinum we could show that the type VII secretion system ESX-5 is essential for PE_PGRS33 export.
    CitationOver-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010jlew19747546Rv2250c and Rv1818c interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen.
    CitationA comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. PP. Singh, M. Parra et al. Microbiology (Reading, Engl.) 2008jlew18957600More persistent. Overexpress in MS and infect macrophages and mice.
    CitationPE is a functional domain responsible for protein translocation and localization on mycobacterial cell wall. A. Cascioferro, G. Delogu et al. Mol. Microbiol. 2007jlew18028308Protein is surface exposed and localizes in the cell wall. PE domain for cell wall localization
    CitationPE_PGRS proteins are differentially expressed by Mycobacterium tuberculosis in host tissues. G. Delogu, M. Sanguinetti et al. Microbes Infect. 2006jlew16798044in axenic cultures, significant up-regulation occurring at late log and early stationary phases. quantitative real-time RT-PCR (QRT-PCR) was implemented to assess expression of three PE_PGRS genes under different experimental conditions.
    CitationVariable expression patterns of Mycobacterium tuberculosis PE_PGRS genes: evidence that PE_PGRS16 and PE_PGRS26 are inversely regulated in vivo. V. Dheenadhayalan, G. Delogu et al. J. Bacteriol. 2006jlew16672626Constitutively expressed in all in vitro conditions examined. Evaluation of expression of 16 PE_PGRS genes present in Mycobacterium tuberculosis under various growth conditions

    Comments