TB Genome Annotation Portal

Rv1782 (eccB5)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ESX-5 secretion system protein eccB5
  • REFSEQ: hypothetical protein
  • PATRIC: Possible membrane protein
  • TUBERCULIST: ESX conserved component EccB5. ESX-5 type VII secretion system protein. Probable membrane protein.
  • NCBI: ESX conserved component EccB5 ESX-5 type VII secretion system protein Probable membrane protein
  • updated information (H37Rv4):
    • gene name: eccB5
    • function:
    • reference:
• Type: Essential
• Start: 2017740
• End: 2019260
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0043022 - ribosome binding (FLUTE) (FLUTE Assigned!)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6SGY	39%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structure of EccB3 dimer from the ESX-3 core complex

• Links to additional information on eccB5:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.726 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VAEESRGQRGSGYGLGLSTRTQVTGYQFLARRTAMALTRWRVRMEIEPGRRQTLAVVASVSAALVICLGALLWSFISPSGQLNESPIIADRDSGALYVRV
GDRLYPALNLASARLITGRPDNPHLVRSSQIATMPRGPLVGIPGAPSSFSPKSPPASSWLVCDTVATSSSIGSLQGVTVTVIDGTPDLTGHRQILSGSDA
VVLRYGGDAWVIREGRRSRIEPTNRAVLLPLGLTPEQVSQARPMSRALFDALPVGPELLVPEVPNAGGPATFPGAPGPIGTVIVTPQISGPQQYSLVLGD
GVQTLPPLVAQILQNAGSAGNTKPLTVEPSTLAKMPVVNRLDLSAYPDNPLEVVDIREHPSTCWWWERTAGENRARVRVVSGPTIPVAATEMNKVVSLVK
ADTSGRQADQVYFGPDHANFVAVTGNNPGAQTSESLWWVTDAGARFGVEDSKEARDALGLTLTPSLAPWVALRLLPQGPTLSRADALVEHDTLPMDMTPA
ELVVPK

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.36 (0.2)	1.11 (0.42)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link