Rv1782 (eccB5)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: ESX-5 secretion system protein eccB5
REFSEQ: hypothetical protein
PATRIC: Possible membrane protein
TUBERCULIST: ESX conserved component EccB5. ESX-5 type VII secretion system protein. Probable membrane protein.
NCBI: ESX conserved component EccB5 ESX-5 type VII secretion system protein Probable membrane protein
updated information (H37Rv4):
gene name: eccB5
function:
reference:
Coordinates in H37Rv: 2017740 - 2019260
Gene length: 1521 bp (with stop codon), 506 aa (without stop codon)
Operon:
Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 7NPV 99% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MycP5-free ESX-5 inner membrane complex, State II 7NPU 99% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MycP5-free ESX-5 inner membrane complex, state I 7NPS 99% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Structure of the periplasmic assembly from the ESX-5 inner membrane complex, C1 model 7NPR 99% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Structure of an intact ESX-5 inner membrane complex, Composite C3 model 7NP7 99% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Structure of an intact ESX-5 inner membrane complex, Composite C1 model 7B9S 75% Mycobacterium xenopi RIVM700367 Structure of the mycobacterial ESX-5 Type VII Secretion System hexameric pore complex 7B9F 75% Mycobacterium xenopi RIVM700367 Structure of the mycobacterial ESX-5 Type VII Secretion System hexameric pore complex 6SGY 39% Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Structure of EccB3 dimer from the ESX-3 core complex 6LAR 38% Mycolicibacterium smegmatis MC2 155 Structure of ESX-3 complex
Links to additional information on eccB5:
Amino Acid Sequence
VAEESRGQRGSGYGLGLSTRTQVTGYQFLARRTAMALTRWRVRMEIEPGRRQTLAVVASVSAALVICLGALLWSFISPSGQLNESPIIADRDSGALYVRV
GDRLYPALNLASARLITGRPDNPHLVRSSQIATMPRGPLVGIPGAPSSFSPKSPPASSWLVCDTVATSSSIGSLQGVTVTVIDGTPDLTGHRQILSGSDA
VVLRYGGDAWVIREGRRSRIEPTNRAVLLPLGLTPEQVSQARPMSRALFDALPVGPELLVPEVPNAGGPATFPGAPGPIGTVIVTPQISGPQQYSLVLGD
GVQTLPPLVAQILQNAGSAGNTKPLTVEPSTLAKMPVVNRLDLSAYPDNPLEVVDIREHPSTCWWWERTAGENRARVRVVSGPTIPVAATEMNKVVSLVK
ADTSGRQADQVYFGPDHANFVAVTGNNPGAQTSESLWWVTDAGARFGVEDSKEARDALGLTLTPSLAPWVALRLLPQGPTLSRADALVEHDTLPMDMTPA
ELVVPK
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1782/eccB5,
gene len: 1520 bp, num TA sites: 20
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio growth defect 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro no data 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath uncertain M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.29) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1782: 0.352541621
lineage-specific pN/pS in L1: 0.280225391
lineage-specific pN/pS in L2: 0.348939663
lineage-specific pN/pS in L3: 0.310323674
lineage-specific pN/pS in L4: 0.40017035
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.8 (0.38)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006 aparna.vchalam IDA 17076665 Spectrophotometry
Interaction PhysicalInteraction Rv2430c aparna.vchalam IDA SpectrophotometryAM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Citation The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008 aparna.vchalam IDA 18974870 Spectrophotometry
Interaction PhysicalInteraction Rv2430c aparna.vchalam IDA SpectrophotometryS. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Citation The ESX-5 secretion system of Mycobacterium marinum modulates the macrophage response. authors,AM. Abdallah,ND. Savage,M. van Zon,L. Wilson,CM. Vandenbroucke-Grauls,NN. van der Wel,TH. Ottenhoff,W. Bitter J. Immunol. 2008 aparna.vchalam IDA 18981138 Spectrophotometry
Interaction PhysicalInteraction Rv2430c aparna.vchalam IDA Spectrophotometryauthors,AM. Abdallah,ND. Savage,M. van Zon,L. Wilson,CM. Vandenbroucke-Grauls,NN. van der Wel,TH. Ottenhoff,W. Bitter The ESX-5 secretion system of Mycobacterium marinum modulates the macrophage response. J. Immunol. 2008
Citation A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006 priyadarshinipriyanka2001 IDA 17076665 Spectrophotometry
Interaction PhysicalInteraction Rv2430c priyadarshinipriyanka2001 IDA SpectrophotometryAM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Citation The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008 priyadarshinipriyanka2001 IDA 18974870 Spectrophotometry
Interaction PhysicalInteraction Rv2430c priyadarshinipriyanka2001 IDA SpectrophotometryS. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Citation The ESX-5 secretion system of Mycobacterium marinum modulates the macrophage response. authors,AM. Abdallah,ND. Savage,M. van Zon,L. Wilson,CM. Vandenbroucke-Grauls,NN. van der Wel,TH. Ottenhoff,W. Bitter J. Immunol. 2008 priyadarshinipriyanka2001 IDA 18981138 Spectrophotometry
Interaction PhysicalInteraction Rv2430c priyadarshinipriyanka2001 IDA Spectrophotometryauthors,AM. Abdallah,ND. Savage,M. van Zon,L. Wilson,CM. Vandenbroucke-Grauls,NN. van der Wel,TH. Ottenhoff,W. Bitter The ESX-5 secretion system of Mycobacterium marinum modulates the macrophage response. J. Immunol. 2008