Rv1779c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: integral membrane protein
- PATRIC: FIG00821637: hypothetical protein
- TUBERCULIST: Possible integral membrane protein
- NCBI: Possible integral membrane protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 2012686
End: 2014479
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1779c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.338 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology
- Mycobrowser
- PATRIC

Amino Acid Sequence

MCAHEYAEQRSAVSGIEGLLTWLGGGHWRELGERHERSTHAVAGVIVAVGAALAGLLASLAVSEAAQGPISSPIGAASLALVLGLLVGAVTRGTASGPAR
GRAGVTGRASVAVAVGFVVGELAALVMFSGAIDRRLDEQAMHSADATPAAVQASASLQQARNARTALDSAVERARGRLDDALVVARCEYHPTPACPQTRI
TGVPGRGPETRTANQLLADAQRELDNALAARDHQAPALDAKMAHDEQALAEVRQAVVADAGRGLGSRWVAMNDLTLASAGALTARMLAIAFFALLYLLPL
ILRLWRGDTTHDRHAAARAERERAELEADTAIAIKRAEVRRAAEIMWAEHQLTQTRLAIEAQAEIDREQQRRRVVEALEGPVRASSERTLQPVEDEVYLP
IAAETEAASRTVAQLPAGAAHHRPGIAKNLPAQVQPEGAVEPREKRATPVIRSIPDATKAAARWIRPLVPPFVARMLDNTTAPLRTARQVFEEVEEIAFS
FKRTHKVTVNAEGSDPNDQPPLESHSPAAPAESNPIASSDSARRSRLATNDDHPPLAQVPPRDLASLSVGSTGELTQREGPHELRSPDGPRQLPPPR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.187950; 5 non-insertions in a row out of 14 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.146400; 4 non-insertions in a row out of 14 sites
Uncertain	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.159500; 4 non-insertions in a row out of 14 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.122300; 4 non-insertions in a row out of 15 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.119600; 4 non-insertions in a row out of 15 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv2258c (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. G. Bai, LA. McCue et al. J. Bacteriol. 2005	priyadarshinipriyanka2001	IDA	16267303	Band shift
Interaction	Transcription Rv3676	priyadarshinipriyanka2001	IDA		Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Citation	Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. G. Bai, LA. McCue et al. J. Bacteriol. 2005	aparna.vchalam	IDA	16267303	Band shift
Interaction	Transcription Rv3676	aparna.vchalam	IDA		Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3676	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

TB Genome Annotation Portal