Rv1759c (wag22)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: WAG22 antigen
- REFSEQ: PE-PGRS family protein
- PATRIC: PE-PGRS FAMILY PROTEIN
- TUBERCULIST: PE-PGRS family protein Wag22
- NCBI: PE-PGRS family protein Wag22
- updated information (H37Rv4):
  - gene name: wag22
  - function:
  - reference:
Type: Not Target
Start: 1989833
End: 1992577
Operon:

Trans-membrane region:
Role: IV.C.1.b - PE_PGRS subfamily
GO terms:
- GO:0005576 - extracellular region (Uniprot)
- GO:0005515 - protein binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

5XFS 48% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
Links to additional information on wag22:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.154 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
5XFS	48%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis

Amino Acid Sequence

MSFVIAVPETIAAAATDLADLGSTIAGANAAAAANTTSLLAAGADEISAAIAALFGAHGRAYQAASAEAAAFHGRFVQALTTGGGAYAAAEAAAVTPLLN
SINAPVLAATGRPLIGNGANGAPGTGANGGDAGWLIGNGGAGGSGAKGANGGAGGPGGAAGLFGNGGAGGAGGTATANNGIGGAGGAGGSAMLFGAGGAG
GAGGAATSLVGGIGGTGGTGGNAGMLAGAAGAGGAGGFSFSTAGGAGGAGGAGGLFTTGGVGGAGGQGHTGGAGGAGGAGGLFGAGGMGGAGGFGDHGTL
GTGGAGGDGGGGGLFGAGGDGGAGGSGLTTGGAAGNGGNAGTLSLGAAGGAGGTGGAGGTVFGGGKGGAGGAGGNAGMLFGSGGGGGTGGFGFAAGGQGG
VGGSAGMLSGSGGSGGAGGSGGPAGTAAGGAGGAGGAPGLIGNGGNGGNGGESGGTGGVGGAGGNAVLIGNGGEGGIGALAGKSGFGGFGGLLLGADGYN
APESTSPWHNLQQDILSFINEPTEALTGRPLIGNGDSGTPGTGDDGGAGGWLFGNGGNGGAGAAGTNGSAGGAGGAGGILFGTGGAGGAGGVGTAGAGGA
GGAGGSAFLIGSGGTGGVGGAATTTGGVGGAGGNAGLLIGAAGLGGCGGGAFTAGVTTGGAGGTGGAAGLFANGGAGGAGGTGSTAGGAGGAGGAGGLYA
HGGTGGPGGNGGSTGAGGTGGAGGPGGLYGAGGSGGAGGHGGMAGGGGGVGGNAGSLTLNASGGAGGSGGSSLSGKAGAGGAGGSAGLFYGSGGAGGNGG
YSLNGTGGDGGTGGAGQITGLRSGFGGAGGAGGASDTGAGGNGGAGGKAGLYGNGGDGGAGGDGATSGKGGAGGNAVVIGNGGNGGNAGKAGGTAGAGGA
GGLVLGRDGQHGLT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.634550; 8 non-insertions in a row out of 26 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.141100; 5 non-insertions in a row out of 26 sites
Uncertain	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.947950; 8 non-insertions in a row out of 26 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.039250; 4 non-insertions in a row out of 27 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.035550; 4 non-insertions in a row out of 27 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.55
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Interaction	RegulatedBy Rv3676	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The PGRS domain of Mycobacterium tuberculosis PE_PGRS Rv1759c antigen is an efficient subunit vaccine to prevent reactivation in a murine model of chronic tuberculosis. J. Campuzano, D. Aguilar et al. Vaccine 2007	jlew		17399860	Using an experimental model of chronic tuberculosis in B6D2F1 mice, we observed constant expression of Rv1759c on the cell wall of phagocytosed mycobacteria by activated macrophages located in lung granulomas.

TB Genome Annotation Portal