TB Genome Annotation Portal

Rv1747 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: transmembrane ATP-binding protein ABC transporter
  • PATRIC: Probable conserved transmembrane ATP-binding protein ABC transporter
  • TUBERCULIST: Probable conserved transmembrane ATP-binding protein ABC transporter
  • NCBI: Probable conserved transmembrane ATP-binding protein ABC transporter
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1973630
• End: 1976227
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0055085 - transmembrane transport (Uniprot)
  • GO:0042626 - ATPase activity, coupled to transmembrane movement of substances (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 0.48 ATP[c] + 0.48 TREHALOSEMONOMYCOLATE_40_CY_41_[c] -> 0.48 ADP[c] + 0.48 PI[c] + TREHALOSEMONOMYCOLATE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6CCD	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	The crystal structure of Mycobacterium tuberculosis Rv1747 FHA-1
  6CAH	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	NMR-based structure of the FHA-2 domain from Mycobacterium tuberculosis ABC transporter Rv1747
  6I2S	44%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (R802A) in complex with GarA, following 2-oxoglutarate soak
  6I2R	44%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), mutant R802A, in complex with GarA
  6I2Q	44%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the wild-type SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), in complex with GarA
  2KKL	42%	Mycobacterium bovis	Solution NMR structure of FHA domain of Mb1858 from Mycobacterium bovis. Northeast Structural Genomics Consortium Target MbR243C (24-155).
  2FF4	38%	Mycobacterium tuberculosis	Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide
  2FEZ	38%	Mycobacterium tuberculosis	Mycobacterium tuberculosis EmbR
  3PIH	37%	Thermotoga maritima	T. maritima UvrA in complex with fluorescein-modified DNA
  6VXJ	36%	Homo sapiens	Structure of ABCG2 bound to SN38

• Links to additional information on Rv1747:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.988 (from Jeremy Rock's lab)

Amino Acid Sequence

VPMSQPAAPPVLTVRYEGSERTFAAGHDVVVGRDLRADVRVAHPLISRAHLLLRFDQGRWVAIDNGSLNGLYLNNRRVPVVDIYDAQRVHIGNPDGPALD
FEVGRHRGSAGRPPQTTSIRLPNLSAGAWPTDGPPQTGTLGSGQLQQLPPATTRIPAAPPSGPQPRYPTGGQQLWPPSGPQRAPQIYRPPTAAPPPAGAR
GGTEAGNLATSMMKILRPGRLTGELPPGAVRIGRANDNDIVIPEVLASRHHATLVPTPGGTEIRDNRSINGTFVNGARVDAALLHDGDVVTIGNIDLVFA
DGTLARREENLLETRVGGLDVRGVTWTIDGDKTLLDGISLTARPGMLTAVIGPSGAGKSTLARLVAGYTHPTDGTVTFEGHNVHAEYASLRSRIGMVPQD
DVVHGQLTVKHALMYAAELRLPPDTTKDDRTQVVARVLEELEMSKHIDTRVDKLSGGQRKRASVALELLTGPSLLILDEPTSGLDPALDRQVMTMLRQLA
DAGRVVLVVTHSLTYLDVCDQVLLLAPGGKTAFCGPPTQIGPVMGTTNWADIFSTVADDPDAAKARYLARTGPTPPPPPVEQPAELGDPAHTSLFRQFST
IARRQLRLIVSDRGYFVFLALLPFIMGALSMSVPGDVGFGFPNPMGDAPNEPGQILVLLNVGAVFMGTALTIRDLIGERAIFRREQAVGLSTTAYLIAKV
CVYTVLAVVQSAIVTVIVLVGKGGPTQGAVALSKPDLELFVDVAVTCVASAMLGLALSAIAKSNEQIMPLLVVAVMSQLVFSGGMIPVTGRVPLDQMSWV
TPARWGFAASAATVDLIKLVPGPLTPKDSHWHHTASAWWFDMAMLVALSVIYVGFVRWKIRLKAC

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.87 (0.68)	1.59 (0.71)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link