Rv1739c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: sulfate permease
- REFSEQ: sulphate-transport transmembrane protein ABC transporter
- PATRIC: Sulfate transporter
- TUBERCULIST: Probable sulphate-transport transmembrane protein ABC transporter
- NCBI: Probable sulphate-transport transmembrane protein ABC transporter
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1965955
End: 1967637
Operon:

Trans-membrane region:
Role: III.A.4 - Anions
GO terms:
- GO:1902358 - sulfate transmembrane transport (Uniprot)
- GO:0071422 - succinate transmembrane transport (Uniprot)
- GO:0070778 - L-aspartate transmembrane transport (Uniprot)
- GO:0055085 - transmembrane transport (Uniprot)
- GO:0019001 - guanyl nucleotide binding (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0015741 - fumarate transport (Uniprot)
- GO:0015183 - L-aspartate transmembrane transporter activity (Uniprot)
- GO:0015141 - succinate transmembrane transporter activity (Uniprot)
- GO:0015138 - fumarate transmembrane transporter activity (Uniprot)
- GO:0015116 - sulfate transmembrane transporter activity (Uniprot)
- GO:0008272 - sulfate transport (Uniprot)
- GO:0008271 - secondary active sulfate transmembrane transporter activity (Uniprot)
- GO:0005887 - integral component of plasma membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0000103 - sulfate assimilation (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

2KLN 100% Mycobacterium bovis Solution Structure of STAS domain of RV1739c from M. tuberculosis
Links to additional information on Rv1739c:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.223 (from Jeremy Rock's lab)

PDB	aa ident	species	PDB title
2KLN	100%	Mycobacterium bovis	Solution Structure of STAS domain of RV1739c from M. tuberculosis

Amino Acid Sequence

MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVAGLPPAAGLWASIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGD
LRRYAVLAATLGLLVGLICLLAGTARLGFLASLRSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVTRVHWPTFVLAMSVLALLTML
TRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSGLPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACN
IAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGALVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLG
VFYGVLAAVALSILELLRRVAHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLT
ALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000550; 4 non-insertions in a row out of 41 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 41 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 41 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 42 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 42 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.81
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0678 (-) (Direct binding)
- Rv0967 (csoR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. E. Wooff, SL. Michell et al. Mol. Microbiol. 2002	njamshidi	IDA	11929522	PMID: 11929522
Term	TBRXN:SULabc sulfate transport via ABC system - IDA	njamshidi	IDA	11929522	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Citation	Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. E. Wooff, SL. Michell et al. Mol. Microbiol. 2002	njamshidi	ISS	11929522	PMID: 11929522
Term	TBRXN:SULabc sulfate transport via ABC system - ISS	njamshidi	ISS	11929522	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Interaction	PhysicalInteraction Rv2400c	kholia.trupti	RCA		Gene neighbourhood (Functional linkage) authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	kholia.trupti	RCA		Gene neighbourhood (Functional linkage) authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	kholia.trupti	RCA		Gene neighbourhood (Functional linkage) authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	kholia.trupti	RCA		Gene neighbourhood (Functional linkage) authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	shahanup86	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	shahanup86	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2400c	shahanup86	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Citation	Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. authors,N. Jamshidi,B. Palsson BMC Syst Biol 2007	vashishtrv	NAS	17555602	None
Interaction	PhysicalInteraction Rv2397c	vashishtrv	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	vashishtrv	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	vashishtrv	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2400c	vashishtrv	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Citation	Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. authors,N. Jamshidi,B. Palsson BMC Syst Biol 2007	shahanup86	NAS	17555602	None
Interaction	PhysicalInteraction Rv2397c	shahanup86	NAS		authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007

TB Genome Annotation Portal