TB Genome Annotation Portal

Rv1720c (vapC12)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: toxin
  • REFSEQ: hypothetical protein
  • PATRIC: Toxin 1 PIN domain
  • TUBERCULIST: Possible toxin VapC12
  • NCBI: Possible toxin VapC12
  • updated information (H37Rv4):
    • gene name: vapC12
    • function:
    • reference:
• Type: Not Target
• Start: 1947030
• End: 1947419
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0090501 - RNA phosphodiester bond hydrolysis (Uniprot)
  • GO:0090305 - nucleic acid phosphodiester bond hydrolysis (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0004540 - ribonuclease activity (Uniprot)
  • GO:0004518 - nuclease activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on vapC12:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.013 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFTQRAYQLRSTHTVADGAYVAL
AEGLGVPLITCDGRLAQSHGHNAEIELVA

Additional Information