Rv1708 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: chromosome partitioning protein
- REFSEQ: putative initiation inhibitor protein
- PATRIC: Chromosome (plasmid) partitioning protein ParA / Sporulation initiation inhibitor protein Soj
- TUBERCULIST: Putative initiation inhibitor protein
- NCBI: Putative initiation inhibitor protein
- updated information (H37Rv4):
  - gene name: minD
  - function: cell division
  - reference: Kishore (2023) PMID: 37526955
Type: Essential
Start: 1936360
End: 1937316
Operon:

Trans-membrane region:
Role: III.C - Cell division
GO terms:
- GO:0043590 - bacterial nucleoid (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2BEJ	44%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
1WCV	44%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
5IHP	44%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ADP and Magnesium
5IF9	44%	Mycobacterium smegmatis	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
4PFS	44%	Mycobacterium smegmatis	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis
2BEK	44%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
6IUD	37%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj-ADP complex bound to DNA
6IUC	37%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj-ATP complex bound to DNA
6IUB	37%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj protein

Links to additional information on Rv1708:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -6.364 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

LPAGLPGQASVAVRLSCDVPPDARHHEPRPGMTDHPDTGNGIGLTGRPPRAIPDPAPRSSHGPAKVIAMCNQKGGVGKTTSTINLGAALGEYGRRVLLVD
MDPQGALSAGLGVPHYELDKTIHNVLVEPRVSIDDVLIHSRVKNMDLVPSNIDLSAAEIQLVNEVGREQTLARALYPVLDRYDYVLIDCQPSLGLLTVNG
LACTDGVIIPTECEFFSLRGLALLTDTVDKVRDRLNPKLDISGILITRYDPRTVNSREVMARVVERFGDLVFDTVITRTVRFPETSVAGEPITTWAPKSA
GALAYRALARELIDRFGM

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999600; 16 non-insertions in a row out of 19 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 19 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 19 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 19 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999900; 16 non-insertions in a row out of 19 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.08
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv2989 (-) (Direct binding)
- Rv0135c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	PMID	Comment
Symbol	ParA-like protein	rslayden		alternative metabolism response, encoded with ScpA, ScpB (Rv1709, 1710) RA. Slayden, DL. Knudson et al. Identification of cell cycle regulators in Mycobacterium tuberculosis by inhibition of septum formation and global transcriptional analysis. Microbiology (Reading, Engl.) 2006
Name	Initiation inhibition protein, septum site regulation	rslayden		alternative metabolism response, encoded with ScpA, ScpB (Rv1709, 1710) RA. Slayden, DL. Knudson et al. Identification of cell cycle regulators in Mycobacterium tuberculosis by inhibition of septum formation and global transcriptional analysis. Microbiology (Reading, Engl.) 2006
Citation	Identification of cell cycle regulators in Mycobacterium tuberculosis by inhibition of septum formation and global transcriptional analysis. RA. Slayden, DL. Knudson et al. Microbiology (Reading, Engl.) 2006	rslayden	16735741	alternative metabolism response, encoded with ScpA, ScpB (Rv1709, 1710)

TB Genome Annotation Portal