Rv1696 (recN)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: DNA repair protein recN
- REFSEQ: DNA repair protein recN (recombination protein N)
- PATRIC: DNA repair protein RecN
- TUBERCULIST: Probable DNA repair protein RecN (recombination protein N)
- NCBI: Probable DNA repair protein RecN (recombination protein N)
- updated information (H37Rv4):
  - gene name: recN
  - function:
  - reference:
Type: Not Target
Start: 1919683
End: 1921446
Operon:

Trans-membrane region:
Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
GO terms:
- GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
- GO:0006310 - DNA recombination (Uniprot)
- GO:0006281 - DNA repair (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on recN:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.156 (from Jeremy Rock's lab)

Amino Acid Sequence

VLTELRIESLGAISVATAEFDRGFTVLTGETGTGKTMVVTGLHLLGGARADATRVRSGADRAVVEGRFTTTDLDDATVAGLQAVLDSSGAERDEDGSVIA
LRSISRDGPSRAYLGGRGVPAKSLSGFTNELLTLHGQNDQLRLMRPDEQRGALDRFAAAGEAVQRYRKLRDAWLTARRDLVDRRNRARELAQEADRLKFA
LNEIDTVDPQPGEDVALVADIARLSELDTLREAATTARATLCGTPDADAFDRGAVDSLGRARAALQSSDDAALRGLAEQVGEALTVVVDAVAELGAYLDE
LPADASALDAKLARQAQLRTLTRKYAADIDGVLRWADEARARLAQLDVSEEGLAALERRTGELAHELGQAAVDLSTIRRKAAKRLAKEVSAELSALAMAD
AEFTIGVTTELADHGDPVALALASGELARAGADGVDAVEFGFVAHRGMTVLPLAKSASGGELSRVMLSLEVVLATSRKQAAGTTMVFDEIDAGVGGWAAV
QIGRRLARLARTHQVIVVTHLPQVAAYADVHLMVQRTGRDGASGVRRLTSEDRVAELARMLAGLGDSDSGRAHARELLETAQNDELT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.371150; 7 non-insertions in a row out of 21 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 21 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 21 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.255550; 5 non-insertions in a row out of 22 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.038200; 3 non-insertions in a row out of 22 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.8
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-) (Upstream of operon)
- Rv1985c (-) (Upstream of operon)
- Rv3246c (mtrA) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Role of stress response sigma factor SigG in Mycobacterium tuberculosis. JH. Lee, DE. Geiman et al. J. Bacteriol. 2008	salluamity1	IEP	18039768	Co-expression (Functional linkage)
Interaction	Regulatory Rv3286c	salluamity1	IEP		Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Citation	The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005	salluamity1	IEP	16199577	Co-expression (Functional linkage)
Interaction	Regulatory Rv0735	salluamity1	IEP		Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	RegulatedBy Rv2720	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2720	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Other	TBPWY:Recombination repair	vmizrahi			Increased expression in Mtb from clinical lung samples

TB Genome Annotation Portal