Rv1686c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: DrrB family ABC transporter efflux protein
- REFSEQ: integral membrane protein ABC transporter
- PATRIC: ABC drug efflux pump inner membrane subunit DrrB family
- TUBERCULIST: Probable conserved integral membrane protein ABC transporter
- NCBI: Probable conserved integral membrane protein ABC transporter
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1911401
End: 1912081
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:1900753 - doxorubicin transport (Uniprot)
- GO:0055085 - transmembrane transport (Uniprot)
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0043215 - daunorubicin transport (Uniprot)
- GO:0043190 - ATP-binding cassette (ABC) transporter complex (Uniprot)
- GO:0042891 - antibiotic transport (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0010033 - response to organic substance (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 0.48 ATP[c] + 0.48 TREHALOSEMONOMYCOLATE_40_CY_41_[c] -> 0.48 ADP[c] + 0.48 PI[c] + TREHALOSEMONOMYCOLATE[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1686c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.211 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MILLVPILIITLMYFMFENVPHRPGTPSGFNTACLVLLGLFPLFVMFVITAITMQRERASGTLERILTTPLRRLDLLAGYGTAFSIAAAAQATLACIVAF
WFLGFDTAGSPVWVFAIAIVNAVLGVGLGLLCSAFARTEFQAVQFIPLVMVPQLLLAGIIVPRALMPTWLEWISNVMPASYALEALQQVGAHPELTGIAV
RDVVVVLSFAVASLCLAAVTLRRRTS

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.962700; 9 non-insertions in a row out of 13 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 13 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 13 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 5 non-insertions in a row out of 14 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.775250; 6 non-insertions in a row out of 14 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0678 (-) (Direct binding)
- Rv1473A (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0081 (-)
- Rv3133c (devR)
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	A putative ABC-transport operon of Mycobacterium smegmatis. authors,EK. Barsom,GF. Hatfull Gene 1997	hibeeluck	ISS	9034323	None
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,EK. Barsom,GF. Hatfull A putative ABC-transport operon of Mycobacterium smegmatis. Gene 1997
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,EK. Barsom,GF. Hatfull A putative ABC-transport operon of Mycobacterium smegmatis. Gene 1997
Interaction	Signaling Rv1687c	hibeeluck	ISS		authors,EK. Barsom,GF. Hatfull A putative ABC-transport operon of Mycobacterium smegmatis. Gene 1997
Interaction	PhysicalInteraction Rv1687c	salluamity1	ISS		TJ. Sullivan, JJ. Truglio et al. High affinity InhA inhibitors with activity against drug-resistant strains of Mycobacterium tuberculosis. ACS Chem. Biol. 2006
Interaction	PhysicalInteraction Rv1687c	salluamity1	ISS		K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv1685c	shahanup86	NAS		TJ. Sullivan, JJ. Truglio et al. High affinity InhA inhibitors with activity against drug-resistant strains of Mycobacterium tuberculosis. ACS Chem. Biol. 2006
Citation	The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. authors,M. Braibant,P. Gilot,J. Content FEMS Microbiol. Rev. 2000	hibeeluck	ISS	10978546	None
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	Signaling Rv1687c	hibeeluck	ISS		authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Citation	A new subfamily of bacterial ABC-type transport systems catalyzing export of drugs and carbohydrates. authors,J. Reizer,A. Reizer,MH. Saier Protein Sci. 1992	hibeeluck	ISS	1303751	None
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,J. Reizer,A. Reizer,MH. Saier A new subfamily of bacterial ABC-type transport systems catalyzing export of drugs and carbohydrates. Protein Sci. 1992
Interaction	Signaling Rv1686c	hibeeluck	ISS		authors,J. Reizer,A. Reizer,MH. Saier A new subfamily of bacterial ABC-type transport systems catalyzing export of drugs and carbohydrates. Protein Sci. 1992
Interaction	Signaling Rv1687c	hibeeluck	ISS		authors,J. Reizer,A. Reizer,MH. Saier A new subfamily of bacterial ABC-type transport systems catalyzing export of drugs and carbohydrates. Protein Sci. 1992

TB Genome Annotation Portal