TB Genome Annotation Portal

Rv1658 (argG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: argininosuccinate synthase
  • REFSEQ: argininosuccinate synthase
  • PATRIC: Argininosuccinate synthase (EC 6.3.4.5)
  • TUBERCULIST: Probable argininosuccinate synthase ArgG
  • NCBI: Probable argininosuccinate synthase ArgG
  • updated information (H37Rv4):
    • gene name: argG
    • function:
    • reference:
• Type: Not Target
• Start: 1871363
• End: 1872559
• Operon:


• Trans-membrane region:
  
• Role: I.D.1 - Glutamate family
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0006526 - arginine biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004055 - argininosuccinate synthase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000053 - argininosuccinate metabolic process (Uniprot)
  • GO:0000050 - urea cycle (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + CITR[c] + ASP[c] -> PPI[c] + AMP[c] + ARGSUCC[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4XFJ	87%	Mycobacterium thermoresistibile ATCC 19527	Crystal structure of Argininosuccinate synthase from Mycobacterium thermoresistibile in complex with AMPPNP and Arginine
  4U7J	87%	Mycobacterium thermoresistibile	Crystal structure of Argininosuccinate synthase from Mycobacterium thermoresistibile
  7K5Z	43%	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Crystal Structure of Argininosuccinate synthase from Legionella pneumophila Philadelphia 1 in complex with ANPPNP and a substrate analogue Arginine
  6XNQ	43%	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Crystal Structure of Argininosuccinate synthase from Legionella pneumophila Philadelphia 1
  1KOR	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitors
  1KH3	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitor
  1KH2	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with ATP
  1KH1	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase
  1J21	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with ATP and citrulline
  1J20	42%	Thermus thermophilus	Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with product

• Links to additional information on argG:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.437 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGAVEAVVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
HLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLEVLAPVRDYAWTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWNAPTKD
IYAYTEDPTINWGVPDEVIVGFERGVPVSVDGKPVSMLAAIEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RQTDQRWAELVYDGLWYSPLKAALEAFVAKTQEHVSGEVRLVLHGGHIAVNGRRSAESLYDFNLATYDEGDSFDQSAARGFVYVHGLSSKLAARRDLR

Additional Information