TB Genome Annotation Portal

Rv1657 (argR)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: arginine repressor
  • REFSEQ: arginine repressor
  • PATRIC: Arginine pathway regulatory protein ArgR repressor of arg regulon
  • TUBERCULIST: Probable arginine repressor ArgR (AHRC)
  • NCBI: Probable arginine repressor ArgR (AHRC)
  • updated information (H37Rv4):
    • gene name: argR
    • function:
    • reference:
• Type: Not Target
• Start: 1870842
• End: 1871354
• Operon:


• Trans-membrane region:
  
• Role: I.J.1 - Repressors/activators
• GO terms:
  • GO:0051259 - protein complex oligomerization (Uniprot)
  • GO:0034618 - arginine binding (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0006526 - arginine biosynthetic process (Uniprot)
  • GO:0006525 - arginine metabolic process (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0003700 - DNA binding transcription factor activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2zfz, 3cag, 3laj, 3lap, 3bue, 3fhz
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3LAP	100%	Mycobacterium tuberculosis	The Structure of the Intermediate Complex of the Arginine Repressor from Mycobacterium tuberculosis Bound to its DNA Operator and L-canavanine.
  3LAJ	100%	Mycobacterium tuberculosis	The Structure of the Intermediate Complex of the Arginine Repressor from Mycobacterium tuberculosis Bound to its DNA Operator and L-arginine.
  3FHZ	100%	Mycobacterium tuberculosis	Crystal structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and co-repressor, L-arginine
  3ERE	100%	Mycobacterium tuberculosis	Crystal structure of the arginine repressor protein from Mycobacterium tuberculosis in complex with the DNA operator
  3CAG	100%	Mycobacterium tuberculosis	Crystal structure of the oligomerization domain hexamer of the arginine repressor protein from Mycobacterium tuberculosis in complex with 9 arginines.
  3BUE	100%	Mycobacterium tuberculosis	Crystal structure of the C-terminal domain hexamer of ArgR from Mycobacterium tuberculosis
  2ZFZ	100%	Mycobacterium tuberculosis	Crystal structure of the C-terminal domain hexamer of ArgR from Mycobacterium tuberculosis in complex with arginine
  6WJP	54%	Corynebacterium pseudotuberculosis (strain C231)	Crystal structure of Arginine Repressor P115Q mutant from the pathogenic bacterium Corynebacterium pseudotuberculosis bound to arginine
  6WJO	54%	Corynebacterium pseudotuberculosis (strain C231)	Crystal structure of wild-type Arginine Repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis bound to tyrosine
  5JVO	54%	Corynebacterium pseudotuberculosis	Crystal structure of the Arginine Repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis

• Links to additional information on argR:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -3.12 (from Jeremy Rock's lab)

Amino Acid Sequence

MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARL
LGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR

Additional Information