TB Genome Annotation Portal

Rv1654 (argB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: acetylglutamate kinase
  • REFSEQ: acetylglutamate kinase
  • PATRIC: Acetylglutamate kinase (EC 2.7.2.8)
  • TUBERCULIST: Probable acetylglutamate kinase ArgB
  • NCBI: Probable acetylglutamate kinase ArgB
  • updated information (H37Rv4):
    • gene name: argB
    • function:
    • reference: Tiwari (2018) PMID: 30143580
• Type: Not Target
• Start: 1867842
• End: 1868726
• Operon:


• Trans-membrane region:
  
• Role: I.D.1 - Glutamate family
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0034618 - arginine binding (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0006526 - arginine biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0003991 - acetylglutamate kinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + NAGLU[c] -> ADP[c] + NAGLUP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2ap9
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2AP9	99%	Mycobacterium tuberculosis	Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
  2BUF	46%	PSEUDOMONAS AERUGINOSA	Arginine Feed-Back Inhibitable Acetylglutamate Kinase
  2V5H	44%	SYNECHOCOCCUS ELONGATUS	Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942
  2JJ4	44%	SYNECHOCOCCUS ELONGATUS	The complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC7942
  2BTY	42%	THERMOTOGA MARITIMA	Acetylglutamate kinase from Thermotoga maritima complexed with its inhibitor arginine
  4USJ	41%	ARABIDOPSIS THALIANA	N-acetylglutamate kinase from Arabidopsis thaliana in complex with PII from Chlamydomonas reinhardtii
  2RD5	41%	Arabidopsis thaliana	Structural basis for the regulation of N-acetylglutamate kinase by PII in Arabidopsis thaliana

• Links to additional information on argB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -5.214 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSRIEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDV
ARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAV
AEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLESGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRG

Additional Information

Tiwari S, van Tonder AJ, Vilchèze C, Mendes V, Thomas SE, Malek A,
Chen B, Chen M, Kim J, Blundell TL, Parkhill J, Weinrick B, Berney M,
Jacobs WR Jr. Arginine-deprivation-induced oxidative damage sterilizes
Mycobacterium tuberculosis. Proc Natl Acad Sci U S A. 2018 Sep
25;115(39):9779-9784. doi: 10.1073/pnas.1808874115. Epub 2018 Aug
24. PMID: 30143580; PMCID: PMC6166831.