TB Genome Annotation Portal

Rv1653 (argJ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: arginine biosynthesis ArgJ
  • REFSEQ: bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  • PATRIC: Glutamate N-acetyltransferase (EC 2.3.1.35) / N-acetylglutamate synthase (EC 2.3.1.1)
  • TUBERCULIST: Probable glutamate N-acetyltransferase ArgJ
  • NCBI: Probable glutamate N-acetyltransferase ArgJ
  • updated information (H37Rv4):
    • gene name: argJ
    • function:
    • reference:
• Type: Not Target
• Start: 1866631
• End: 1867845
• Operon:


• Trans-membrane region:
  
• Role: I.D.1 - Glutamate family
• GO terms:
  • GO:0103045 - methione N-acyltransferase activity (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006592 - ornithine biosynthetic process (Uniprot)
  • GO:0006526 - arginine biosynthetic process (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004358 - glutamate N-acetyltransferase activity (Uniprot)
  • GO:0004042 - acetyl-CoA:L-glutamate N-acetyltransferase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GLU[c] + NAORN[c] <=> ORN[c] + NAGLU[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3it6, 3it4
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3IT6	100%	Mycobacterium tuberculosis	The Crystal Structure of Ornithine Acetyltransferase complexed with Ornithine from Mycobacterium tuberculosis (Rv1653) at 2.4 A
  3IT6	100%	Mycobacterium tuberculosis	The Crystal Structure of Ornithine Acetyltransferase complexed with Ornithine from Mycobacterium tuberculosis (Rv1653) at 2.4 A
  3IT4	100%	Mycobacterium tuberculosis	The Crystal Structure of Ornithine Acetyltransferase from Mycobacterium tuberculosis (Rv1653) at 1.7 A
  3IT4	100%	Mycobacterium tuberculosis	The Crystal Structure of Ornithine Acetyltransferase from Mycobacterium tuberculosis (Rv1653) at 1.7 A
  1VRA	41%	Bacillus halodurans	Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution
  1VRA	35%	Bacillus halodurans	Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution

• Links to additional information on argJ:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.508 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTDLAGTTRLLRAQGVTAPAGFRAAGVAAGIKASGALDLALVFNEGPDYAAAGVFTRNQVKAAPVLWTQQVLTTGRLRAVILNSGGANACTGPAGFADTH
ATAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKLLAGVAHVVHEMHGGLVGGDEAAHAIMTTDNVPKQVALHHHDNWTVGGMAKGAGMLAPSLAT
MLCVLTTDAAAEPAALERALRRAAAATFDRLDIDGSCSTNDTVLLLSSGASEIPPAQADLDEAVLRVCDDLCAQLQADAEGVTKRVTVTVTGAATEDDAL
VAARQIARDSLVKTALFGSDPNWGRVLAAVGMAPITLDPDRISVSFNGAAVCVHGVGAPGAREVDLSDADIDITVDLGVGDGQARIRTTDLSHAYVEENS
AYSS

Additional Information