Rv1635c (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: hypothetical protein
REFSEQ: transmembrane protein
PATRIC: Possible membrane protein
TUBERCULIST: Probable mannosyltransferase. Probable conserved transmembrane protein.
NCBI: Probable mannosyltransferase Probable conserved transmembrane protein
updated information (H37Rv4):
gene name: -
function:
reference:
Coordinates in H37Rv: 1840572 - 1842242
Gene length: 1671 bp (with stop codon), 556 aa (without stop codon)
Operon:
Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): (none with >35% aa id)
Links to additional information on Rv1635c:
Amino Acid Sequence
MHASRPGAPPHAGLPSRRTAGDQDHRADPKVTRIMSASTLEQPAAAHVDELVARMRGRLLDPLAIAVLAAVISGAWASRPSLWFDEGATISASASRTLPE
LWSLLGHIDAVHGLYYLLMHGWFAIFPPTELWSRLPSCLAIGAAAAGVVVFAKQFSGRTTAVCAGAVFAILPRVTWAGIEARSSALSVAAAVWLTVLLVA
AVRCNTQRRWLLYALVLMLSILVSINLALLVPAYATMVPLLASGKSRKSPVIWWTVVTAAALGAMTPFILFAHGQVWQVGWIAGLNRNIILDVIHRQYFD
HSVPFAILAGLIVAAGIAAHLAGARGPGGDTHRLVLVSAAWIVVPTAVVLIYSATVEPIYYPRYLILTAPAAAVILAVCVVTIARKPWLIAGVVFLLAAA
AFPNYFFTQRGPYAKEGWDYSQVADVISAHAKPGDCLLVDNTAGWRPGPIRALLATRPAAFRSLIDVERGTYGPKVGTLWDGHVAVWLTTAKIDKCPTLW
TIANRDKSLPDHQVGEMLSPGTGFGRTPVYRFPSYLGFRIVERWQFHYSQVVKSTR
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1635c/-,
gene len: 1670 bp, num TA sites: 33
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.25) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-0.071) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.01) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1635c: 0.491503483
lineage-specific pN/pS in L1: 0.418043478
lineage-specific pN/pS in L2: 0.551495819
lineage-specific pN/pS in L3: 0.433318144
lineage-specific pN/pS in L4: 0.53221861
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.18 (0.51)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Symbol capA mjackson IMP PIM, LM and LAM biosynthesis
Name Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase mjackson IMP PIM, LM and LAM biosynthesis
Symbol capA mjackson IDA PIM, LM and LAM biosynthesis
Name Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase mjackson IDA PIM, LM and LAM biosynthesis
Citation Macrophage-specific Mycobacterium tuberculosis genes: identification by green fluorescent protein and kanamycin resistance selection. V. Srivastava, C. Rouanet et al. Microbiology (Reading, Engl.) 2007 jlew 17322185 Reporter finds TB promoters that are upregulated in macrophages compared to in vitro growth.
Symbol capA mjackson Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick J. Biol. Chem. 2006 mjackson 16704981 Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Symbol capA mjackson Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. Cell. Microbiol. 2008
Citation The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter Cell. Microbiol. 2008 mjackson 18070119 Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. Cell. Microbiol. 2008