Rv1635c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: transmembrane protein
- PATRIC: Possible membrane protein
- TUBERCULIST: Probable mannosyltransferase. Probable conserved transmembrane protein.
- NCBI: Probable mannosyltransferase Probable conserved transmembrane protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1840572
End: 1842242
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1635c:
- KEGG - nucleotide and amino acid sequences of gene
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.245 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MHASRPGAPPHAGLPSRRTAGDQDHRADPKVTRIMSASTLEQPAAAHVDELVARMRGRLLDPLAIAVLAAVISGAWASRPSLWFDEGATISASASRTLPE
LWSLLGHIDAVHGLYYLLMHGWFAIFPPTELWSRLPSCLAIGAAAAGVVVFAKQFSGRTTAVCAGAVFAILPRVTWAGIEARSSALSVAAAVWLTVLLVA
AVRCNTQRRWLLYALVLMLSILVSINLALLVPAYATMVPLLASGKSRKSPVIWWTVVTAAALGAMTPFILFAHGQVWQVGWIAGLNRNIILDVIHRQYFD
HSVPFAILAGLIVAAGIAAHLAGARGPGGDTHRLVLVSAAWIVVPTAVVLIYSATVEPIYYPRYLILTAPAAAVILAVCVVTIARKPWLIAGVVFLLAAA
AFPNYFFTQRGPYAKEGWDYSQVADVISAHAKPGDCLLVDNTAGWRPGPIRALLATRPAAFRSLIDVERGTYGPKVGTLWDGHVAVWLTTAKIDKCPTLW
TIANRDKSLPDHQVGEMLSPGTGFGRTPVYRFPSYLGFRIVERWQFHYSQVVKSTR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 32 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 32 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 32 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 32 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 32 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 2.56
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1359 (-) (Direct binding)
- Rv1473A (-) (Direct binding)
- Rv2642 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Symbol	capA	mjackson	IMP		PIM, LM and LAM biosynthesis
Name	Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase	mjackson	IMP		PIM, LM and LAM biosynthesis
Symbol	capA	mjackson	IDA		PIM, LM and LAM biosynthesis
Name	Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase	mjackson	IDA		PIM, LM and LAM biosynthesis
Citation	Macrophage-specific Mycobacterium tuberculosis genes: identification by green fluorescent protein and kanamycin resistance selection. V. Srivastava, C. Rouanet et al. Microbiology (Reading, Engl.) 2007	jlew		17322185	Reporter finds TB promoters that are upregulated in macrophages compared to in vitro growth.
Symbol	capA	mjackson			Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick J. Biol. Chem. 2006	mjackson		16704981	Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,P. Dinadayala,D. Kaur,S. Berg,AG. Amin,VD. Vissa,D. Chatterjee,PJ. Brennan,DC. Crick Genetic basis for the synthesis of the immunomodulatory mannose caps of lipoarabinomannan in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Symbol	capA	mjackson			Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. Cell. Microbiol. 2008
Citation	The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter Cell. Microbiol. 2008	mjackson		18070119	Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Polyprenol phosphomannose-dependent ManLAM-capping mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,BJ. Appelmelk,J. den Dunnen,NN. Driessen,R. Ummels,M. Pak,J. Nigou,G. Larrouy-Maumus,SS. Gurcha,F. Movahedzadeh,J. Geurtsen,EJ. Brown,MM. Eysink Smeets,GS. Besra,PT. Willemsen,TL. Lowary,Y. van Kooyk,JJ. Maaskant,NG. Stoker,P. van der Ley,G. Puzo,CM. Vandenbroucke-Grauls,CW. Wieland,T. van der Poll,TB. Geijtenbeek,AM. van der Sar,W. Bitter The mannose cap of mycobacterial lipoarabinomannan does not dominate the Mycobacterium-host interaction. Cell. Microbiol. 2008

TB Genome Annotation Portal