TB Genome Annotation Portal

Rv1613 (trpA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: tryptophan synthase alpha chain
  • REFSEQ: tryptophan synthase subunit alpha
  • PATRIC: Tryptophan synthase alpha chain (EC 4.2.1.20)
  • TUBERCULIST: Probable tryptophan synthase alpha subunit TrpA
  • NCBI: Probable tryptophan synthase, alpha subunit TrpA
  • updated information (H37Rv4):
    • gene name: trpA
    • function:
    • reference:
• Type: Not Target
• Start: 1812359
• End: 1813171
• Operon:


• Trans-membrane region:
  
• Role: I.D.4 - Aromatic amino acid family
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009073 - aromatic amino acid family biosynthetic process (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006568 - tryptophan metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0004834 - tryptophan synthase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000162 - tryptophan biosynthetic process (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • SER[c] + IGP[c] -> G3P[c] + TRP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6USA	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate- and GSK1-bound form
  6UB9	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - AMINOACRYLATE- AND BRD6309-BOUND FORM
  6UAP	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - open form with BRD6309 bound
  6U6C	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate- and GSK2-bound form
  6E9P	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - open form with BRD0059 bound
  6DWE	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate- and BRD0059-bound form
  5TCJ	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate and BRD4592-bound form
  5TCI	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - BRD4592-bound form
  5TCG	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate-bound form
  5TCF	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of tryptophan synthase from M. tuberculosis - ligand-free form

• Links to additional information on trpA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.188 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAG
GRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAP
ELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSALVTALTEGLPRLRALTGELAAGVRLGMSA

Additional Information