TB Genome Annotation Portal

Rv1611 (trpC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: indole-3-glycerol phosphate synthase
  • REFSEQ: indole-3-glycerol-phosphate synthase
  • PATRIC: Indole-3-glycerol phosphate synthase (EC 4.1.1.48)
  • TUBERCULIST: Probable indole-3-glycerol phosphate synthase TrpC
  • NCBI: Probable indole-3-glycerol phosphate synthase TrpC
  • updated information (H37Rv4):
    • gene name: trpC
    • function:
    • reference:
• Type: Not Target
• Start: 1810240
• End: 1811058
• Operon:


• Trans-membrane region:
  
• Role: I.D.4 - Aromatic amino acid family
• GO terms:
  • GO:0046391 - 5-phosphoribose 1-diphosphate metabolic process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016831 - carboxy-lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009073 - aromatic amino acid family biosynthetic process (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006568 - tryptophan metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0004425 - indole-3-glycerol-phosphate synthase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
  • GO:0000162 - tryptophan biosynthetic process (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • CPAD5P[c] -> CO2[c] + IGP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 4fb7, 3qja, 3t40, 3t78, 3t44, 3t55
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4FB7	100%	Mycobacterium tuberculosis	The apo form of idole-3-glycerol phosphate synthase (TrpC) form Mycobacterium tuberculosis
  3T78	100%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis Indole Glycerol Phosphate Synthase (IGPS) in Complex with 5-Fluoroanthranilate
  3T55	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis Indole Glycerol Phosphate Synthase (IGPS) in complex with Phenoxymethyl Benzoic Acid (PMBA)
  3T44	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis Indole Glycerol Phosphate Synthase (IGPS) in complex with indole glycerol phosphate (IGP) amd anthranilate
  3T40	100%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis Indole Glycerol Phosphate Synthase (IGPS) complex with N-2-Carboxyphenyl Glycine (CPG)
  3QJA	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis Indole-3-glycerol phosphate synthase (TrpC) in apo form
  1VC4	48%	Thermus thermophilus	Crystal Structure of Indole-3-Glycerol Phosphate Synthase (TrpC) from Thermus Thermophilus At 1.8 A Resolution
  6Y88	39%	Pseudomonas aeruginosa	IGPS (Indole-3-glycerol phosphate synthase) from Pseudomonas aeruginosa in complex with substrate inhibitor rCdRP
  3TSM	39%	Brucella melitensis	Crystal structure of Indole-3-glycerol phosphate synthase from Brucella melitensis
  6Y88	39%	Pseudomonas aeruginosa	IGPS (Indole-3-glycerol phosphate synthase) from Pseudomonas aeruginosa in complex with substrate inhibitor rCdRP

• Links to additional information on trpC:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -6.056 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQG
SLDDLDAVRASVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALKAGAKVIGVNARDLMTLDVDR
DCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR

Additional Information