Rv1601 (hisB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: imidazoleglycerol-phosphate dehydratase
- REFSEQ: imidazoleglycerol-phosphate dehydratase
- PATRIC: Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)
- TUBERCULIST: Probable imidazole glycerol-phosphate dehydratase HisB
- NCBI: Probable imidazole glycerol-phosphate dehydratase HisB
- updated information (H37Rv4):
  - gene name: hisB
  - function:
  - reference:
Type: Not Target
Start: 1802035
End: 1802667
Operon:

Trans-membrane region:
Role: I.D.5 - Histidine
GO terms:
- GO:0040007 - growth (Uniprot)
- GO:0016829 - lyase activity (Uniprot)
- GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0004424 - imidazoleglycerol-phosphate dehydratase activity (Uniprot)
- GO:0000105 - histidine biosynthetic process (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- HISOLP[c] -> PI[c] + HISOL[c]
- DIMGP[c] -> IMACP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6KHH	100%	Mycobacterium tuberculosis	Crystal Structure of HisB from Mycobacterium tuberculosis
5ZQN	100%	Mycobacterium tuberculosis H37Rv	Crystal structure of Mycobacterium tuberculosis HisB in complex with a ligand
5XDS	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis HisB bound with an inhibitor
4LPF	100%	Mycobacterium tuberculosis H37Rv	Crystal structure of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
4LOM	100%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis HisB in complex with its substrate
4GQU	100%	Mycobacterium tuberculosis	Crystal structure of HisB from Mycobacterium tuberculosis
2F1D	49%	Arabidopsis thaliana	X-Ray Structure of imidazoleglycerol-phosphate dehydratase
6EZJ	48%	Arabidopsis thaliana	Imidazoleglycerol-phosphate dehydratase
5ELW	48%	Arabidopsis thaliana	A. thaliana IGPD2 in complex with the triazole-phosphonate inhibitor, (R)-C348, to 1.36A resolution
5EL9	48%	Arabidopsis thaliana	A. thaliana IGPD2 in complex with the triazole-phosphonate inhibitor, (S)-C348, to 1.1A resolution

Links to additional information on hisB:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -8.48 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRF
GDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
SGVPSTKGAL

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999700; 15 non-insertions in a row out of 15 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 15 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 15 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 15 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 15 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.02
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3197A (whiB7)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv3197A (whiB7)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. B. Gold, GM. Rodriguez et al. Mol. Microbiol. 2001	shahanup86	IEP	11722747	Co-expression (Functional linkage)
Interaction	Regulatory Rv2711	shahanup86	IEP		Co-expression (Functional linkage) B. Gold, GM. Rodriguez et al. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Mol. Microbiol. 2001
Citation	Biochemical and genetic studies of a histidine regulatory mutant of Streptomyces coelicolor A3 (2). authors,V. Derkos-Sojak,J. Pigac,V. Deli J. Basic Microbiol. 1985	jjmcfadden		3003334	Inferred from direct assay
Term	EC:3.1.3.15 Histidinol-phosphatase. - NR	jjmcfadden	NR		Inferred from direct assay authors,V. Derkos-Sojak,J. Pigac,V. Deli Biochemical and genetic studies of a histidine regulatory mutant of Streptomyces coelicolor A3 (2). J. Basic Microbiol. 1985
Term	EC:4.2.1.19 Imidazoleglycerol-phosphate dehydratase. - NR	jjmcfadden	NR		Inferred from direct assay authors,V. Derkos-Sojak,J. Pigac,V. Deli Biochemical and genetic studies of a histidine regulatory mutant of Streptomyces coelicolor A3 (2). J. Basic Microbiol. 1985

TB Genome Annotation Portal