TB Genome Annotation Portal

Rv1562c (treZ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: malto-oligosyltrehalose trehalohydrolase
  • REFSEQ: maltooligosyltrehalose trehalohydrolase TreZ
  • PATRIC: Malto-oligosyltrehalose trehalohydrolase (EC 3.2.1.141)
  • TUBERCULIST: Maltooligosyltrehalose trehalohydrolase TreZ
  • NCBI: Maltooligosyltrehalose trehalohydrolase TreZ
  • updated information (H37Rv4):
    • gene name: treZ
    • function:
    • reference:
• Type: Not Target
• Start: 1765400
• End: 1767142
• Operon:


• Trans-membrane region:
  
• Role: II.A.8 - Polysaccharides (cytoplasmic)
• GO terms:
  • GO:0033942 - 4-alpha-D-(1->4)-alpha-D-glucanotrehalose trehalohydrolase activity (Uniprot)
  • GO:0030980 - alpha-glucan catabolic process (Uniprot)
  • GO:0016798 - hydrolase activity, acting on glycosyl bonds (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005992 - trehalose biosynthetic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • MALTOOLIGOSYL-TREHALOSE[c] -> TRE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2BY3	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BY2	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BY1	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BY0	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BXZ	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BXY	40%	DEINOCOCCUS RADIODURANS	Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
  2BHZ	40%	DEINOCOCCUS RADIODURANS	Crystal structure of Deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose
  2BHY	40%	DEINOCOCCUS RADIODURANS	Crystal structure of Deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with trehalose
  2BHU	40%	DEINOCOCCUS RADIODURANS	Crystal structure of Deinococcus radiodurans maltooligosyltrehalose trehalohydrolase
  3M07	38%	Salmonella enterica subsp. enterica serovar Typhimurium	1.4 Angstrom Resolution Crystal Structure of Putative alpha Amylase from Salmonella typhimurium.

• Links to additional information on treZ:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.595 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPEFRVWAPKPALVRLDVNGAVHAMTRSADGWWHTTVAAPADARYGYLLDDDPTVLPDPRSARQPDGVHARSQRWEPPGQFGAARTDTGWPGRSVEGAVI
YELHIGTFTTAGTFDAAIEKLDYLVDLGIDFVELMPVNSFAGTRGWGYDGVLWYSVHEPYGGPDGLVRFIDACHARRLGVLIDAVFNHLGPSGNYLPRFG
PYLSSASNPWGDGINIAGADSDEVRHYIIDCALRWMRDFHADGLRLDAVHALVDTTAVHVLEELANATRWLSGQLGRPLSLIAETDRNDPRLITRPSHGG
YGITAQWNDDIHHAIHTAVSGERQGYYADFGSLATLAYTLRNGYFHAGTYSSFRRRRHGRALDTSAIPATRLLAYTCTHDQVGNRALGDRPSQYLTGGQL
AIKAALTLGSPYTAMLFMGEEWGASSPFQFFCSHPEPELAHSTVAGRKEEFAEHGWAADDIPDPQDPQTFQRCKLNWAEAGSGEHARLHRFYRDLIALRH
NEADLADPWLDHLMVDYDEQQRWVVMRRGQLMIACNLGAEPTCVPVSGELVLAWESPIIGDNSTELAAYSLAILRAAEPA

Additional Information