Rv1522c (mmpL12)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: X-X-X-Leu-X-X-Gly heptad repeats
- REFSEQ: transmembrane transport protein MmpL12
- PATRIC: Putative membrane protein MmpL12
- TUBERCULIST: Probable conserved transmembrane transport protein MmpL12
- NCBI: Probable conserved transmembrane transport protein MmpL12
- updated information (H37Rv4):
  - gene name: mmpL12
  - function:
  - reference:
Type: Essential
Start: 1714172
End: 1717612
Operon:

Trans-membrane region:
Role: II.C.4 - Conserved membrane proteins
GO terms:
- GO:0052572 - response to host immune response (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005618 - cell wall (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on mmpL12:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.268 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- Photo of spot titer

Amino Acid Sequence

VARHDEAKAGGLFDRIGNFVVRWPLIVIGCWIAVAAALTLLLPTLQAQAAKREQAPLPPGAPSMVLQKEMSAAFQEKIETSALLLVLLTNENGLGPADEA
VYRKLIENLRADTQDKISVQDFLAVPEMKELLASKDNKAWNLPITFAGDAASPETQAAFKRVAAIVKQTVAGTSLTVHLSGPIATVADLTELGEKDVRII
EIGTAVSVLIILILVYRNLVTMLVPLATIGASVVTAQGTLSGLAEFGLAVNMQAIVFMSAVMIGAGTDYAVFLISRYHDYVRHGEKSDMAVKKALMSIGK
VITASAATVAVTFLAMVFTKLEVFSAVGPAIAVAITVSLLGAVTLLPAILTLTGRRGWIKPRRDLTSRMWRRSGVRIVRRSTIHLVGSLIVLVALAGCTL
LIRFNYDDLKTVPQHVESVKGYEAMNRHFPMNAMTPMVLFIKSPRDLRTPGALADIEMMSREIAELPNIVMVRGLTRPNGEPLKETKVSFQAGEVGGKLD
EATTLLEEHGGELDQLTGGAHQLADALAQIRNEINGAVASSSGIVNTLQAMMDLMGGDKTIRQLENASQYVGRMRALGDNLSGTVTDAEQIATWASPMVN
ALNSSPVCNSDPACRTSRAQLAAIVQAQDDGLLRSIRALAVTLQQTQEYQTLARTVSTLDGQLKQVVSTLKAVDGLPTKLAQMQQGANALADGSAALAAG
VQELVDQVKKMGSGLNEAADFLLGIKRDADKPSMAGFNIPPQIFSRDEFKKGAQIFLSADGHAARYFVQSALNPATTEAMDQVNDILRVADSARPNTELE
DATIGLAGVPTALRDIRDYYNSDMKFIVIATIVIVFLILVILLRALVAPIYLIGSVLISYLSALGIGTLVFQLILGQEMHWSLPGLSFILLVAIGADYNM
LLISRIRDESPHGIRIGVIRTVGSTGGVITSAGLIFAASMFGLVGASINTMAQAGFTIGIGIVLDTFLVRTVTVPALTTMIGRANWWPSELGRDPSTPPT
KADRWLRRVKGHRRKAPIPAPKPPHTKVVRNTNGHASKAATKSVPNGKPADLAEGNGEYLIDHLRRHSLPLFGYAAMPAYDVVDGVSKPNGDGAHIGKEP
VDHLLGHSLPLFGLAGLPSYDRWDDTSIGEPAVGHAGSKPDAKLST

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.991050; 17 non-insertions in a row out of 52 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 7 non-insertions in a row out of 52 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 7 non-insertions in a row out of 52 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.003800; 12 non-insertions in a row out of 52 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.033050; 13 non-insertions in a row out of 52 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3246c (mtrA) (Direct binding)
- Rv3597c (lsr2) (Direct binding)
- Rv3830c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0818 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv2884 (-)
- Rv3849 (espR)

Property	Value	Creator	Evidence	Comment
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0302	yamir.moreno	ISO	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0302	yamir.moreno	ISO	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006

TB Genome Annotation Portal