Rv1494 (mazE4)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: antitoxin
- REFSEQ: hypothetical protein
- PATRIC: FIG00821542: hypothetical protein
- TUBERCULIST: Possible antitoxin MazE4
- NCBI: Possible antitoxin MazE4
- updated information (H37Rv4):
  - gene name: mazE4
  - function:
  - reference:
Type: Conditional
Start: 1686271
End: 1686573
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

5XE3 100% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Endoribonuclease in complex with its cognate antitoxin from Mycobacterial species
Links to additional information on mazE4:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.567 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
5XE3	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Endoribonuclease in complex with its cognate antitoxin from Mycobacterial species

Amino Acid Sequence

VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYESEAERSAARARRNARQQRSAQ

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 8 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000150; 3 non-insertions in a row out of 8 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 8 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 8 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000150; 3 non-insertions in a row out of 8 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.78
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-)
- Rv2887 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0691c (-) (Direct binding)
- Rv1353c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0047c (-)
- Rv2887 (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Inhibits Rv1495	sumaavasthi	ISA		Functional linkage ZL. Shang, L. Bao et al. [Molecular cloning and expression of hypothetical proteins Rv1494 and Rv1495 of M.tuberculosis H37Rv strain.] Nan Fang Yi Ke Da Xue Xue Bao 2007
Interaction	Inhibits Rv1495	sumaavasthi	ISA		Functional linkage authors,G. Mittenhuber Occurrence of mazEF-like antitoxin/toxin systems in bacteria. J. Mol. Microbiol. Biotechnol. 1999
Citation	[Molecular cloning and expression of hypothetical proteins Rv1494 and Rv1495 of M.tuberculosis H37Rv strain.] ZL. Shang, L. Bao et al. Nan Fang Yi Ke Da Xue Xue Bao 2007	sumaavasthi	ISA	17259135	Functional linkage
Interaction	Inhibits Rv1495	sumaavasthi	ISA		Functional linkage ZL. Shang, L. Bao et al. [Molecular cloning and expression of hypothetical proteins Rv1494 and Rv1495 of M.tuberculosis H37Rv strain.] Nan Fang Yi Ke Da Xue Xue Bao 2007
Citation	Occurrence of mazEF-like antitoxin/toxin systems in bacteria. authors,G. Mittenhuber J. Mol. Microbiol. Biotechnol. 1999	sumaavasthi	ISA	10943559	Functional linkage
Interaction	Inhibits Rv1495	sumaavasthi	ISA		Functional linkage authors,G. Mittenhuber Occurrence of mazEF-like antitoxin/toxin systems in bacteria. J. Mol. Microbiol. Biotechnol. 1999
Symbol	MazE4	jlew			We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Citation	Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009	jlew		19016878	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
Symbol	mazEF-4	rslayden			Hypothetical unknown protein
Other	start:1686271	rslayden			Hypothetical unknown protein
Other	stop:1686573	rslayden			Hypothetical unknown protein
Other	strand:+	rslayden			Hypothetical unknown protein

TB Genome Annotation Portal