TB Genome Annotation Portal

Rv1492 (mutA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: methylmalonyl-CoA mutase small subunit
  • REFSEQ: methylmalonyl-CoA mutase small subunit
  • PATRIC: Methylmalonyl-CoA mutase small subunit (EC 5.4.99.2)
  • TUBERCULIST: Probable methylmalonyl-CoA mutase small subunit MutA (MCM)
  • NCBI: Probable methylmalonyl-CoA mutase small subunit MutA (MCM)
  • updated information (H37Rv4):
    • gene name: mutA
    • function:
    • reference:
• Type: Not Target
• Start: 1682157
• End: 1684004
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0031419 - cobalamin binding (Uniprot)
  • GO:0019678 - propionate metabolic process, methylmalonyl pathway (Uniprot)
  • GO:0019652 - lactate fermentation to propionate and acetate (Uniprot)
  • GO:0016866 - intramolecular transferase activity (Uniprot)
  • GO:0016853 - isomerase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0004494 - methylmalonyl-CoA mutase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • SUCCOA[c] + 0.001 COB_III[c] -> RMMALONYLCOA[c]
  • RMMALONYLCOA[c] + 0.001 COB_III[c] -> SUCCOA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6OXD	100%	Mycobacterium tuberculosis	Structure of Mycobacterium tuberculosis methylmalonyl-CoA mutase with adenosyl cobalamin
  6OXC	100%	Mycobacterium tuberculosis	Structure of Mycobacterium tuberculosis methylmalonyl-CoA mutase with adenosyl cobalamin

• Links to additional information on mutA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.386 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSIDVPERADLEQVRGRWRNAVAGVLSKSNRTDSAQLGDHPERLLDTQTADGFAIRALYTAFDELPEPPLPGQWPFVRGGDPLRDVHSGWKVAEAFPANG
ATADTNAAVLAALGEGVSALLIRVGESGVAPDRLTALLSGVYLNLAPVILDAGADYRPACDVMLALVAQLDPGQRDTLSIDLGADPLTASLRDRPAPPIE
EVVAVASRAAGERGLRAITVDGPAFHNLGATAATELAATVAAAVAYLRVLTESGLVVSDALRQISFRLAADDDQFMTLAKMRALRQLWARVAEVVGDPGG
GAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGVGGADTVLVHPFDVAIPGGFPGTAAGFARRIARNTQLLLLEESHVGRVLDPAGGSWFVEELTDRLA
RRAWQRFQAIEARGGFVEAHDFLAGQIAECAARRADDIAHRRLAITGVNEYPNLGEPALPPGDPTSPVRRYAAGFEALRDRSDHHLARTGARPRVLLLPL
GPLAEHNIRTTFATNLLASGGIEAIDPGTVDAGTVGNAVADAGSPSVAVICGTDARYRDEVADIVQAARAAGVSRVYLAGPEKALGDAAHRPDEFLTAKI
NVVQALSNLLTRLGA

Additional Information