TB Genome Annotation Portal

Rv1484 (inhA)

Amino Acid Sequence

MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQ
TGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMS
AIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL
(Nucleotide sequence available on KEGG)

Additional Information

aka FabI

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.982900;
9 non-insertions in a row out of 9 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.998700;
9 non-insertions in a row out of 9 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.998850;
9 non-insertions in a row out of 9 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.999000;
10 non-insertions in a row out of 10 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.998700;
10 non-insertions in a row out of 10 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.39
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.

    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.

    • Upregulated by:

      • Not upregulated by other genes.

    • Downregulates:

      • Does not downregulate other genes.

    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv1484 (inhA)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:FAS140 fatty acid synthase (n-C14:0) - IDAnjamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
    CitationIdentification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. KH. Choi, L. Kremer et al. J. Biol. Chem. 2000njamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    TermEC:2.3.1.85 Fatty-acid synthase. - IDAnjamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
    InteractionInhibition Rv0197aparna.vchalamIPIAffinity purification (Physical interaction)
    authors,L. Cabusora,E. Sutton,A. Fulmer,CV. Forst Differential network expression during drug and stress response. Bioinformatics 2005
    InteractionInhibition Rv0197aparna.vchalamIPIAffinity purification (Physical interaction)
    ME. Boyne, TJ. Sullivan et al. Targeting fatty acid biosynthesis for the development of novel chemotherapeutics against Mycobacterium tuberculosis: evaluation of A-ring-modified diphenyl ethers as high-affinity InhA inhibitors. Antimicrob. Agents Chemother. 2007
    Name2-trans-Enoyl-ACP reductasemjacksonIDAFAS-II
    CitationPathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005jjmcfadden15653820Inferred from direct assay
    TermEC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    TermEC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    CitationEnzymatic characterization of the target for isoniazid in Mycobacterium tuberculosis. A. Qumard, JC. Sacchettini et al. Biochemistry 1995extern:JZUCKER7599116Reaction blocked in mutant
    TermEC:1.3.1.10 Enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific). - NRextern:JZUCKERNRReaction blocked in mutant
    A. Qumard, JC. Sacchettini et al. Enzymatic characterization of the target for isoniazid in Mycobacterium tuberculosis. Biochemistry 1995
    TermEC:1.3.1.9 Enoyl-[acyl-carrier-protein] reductase (NADH). - NRextern:JZUCKERNRReaction blocked in mutant
    A. Qumard, JC. Sacchettini et al. Enzymatic characterization of the target for isoniazid in Mycobacterium tuberculosis. Biochemistry 1995

    Comments