Rv1483 (fabG1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: 3-oxoacyl-[acyl-carrier-protein] reductase
- REFSEQ: 3-oxoacyl-[acyl-carrier protein] reductase FabG1
- PATRIC: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
- TUBERCULIST: 3-oxoacyl-[acyl-carrier protein] reductase FabG1 (3-ketoacyl-acyl carrier protein reductase) (mycolic acid biosynthesis a protein)
- NCBI: 3-oxoacyl-[acyl-carrier protein] reductase FabG1 (3-ketoacyl-acyl carrier protein reductase) (mycolic acid biosynthesis a protein)
- updated information (H37Rv4):
  - gene name: fabG1
  - function: aka 'mabA'
  - reference:
Type: Not Target
Start: 1673440
End: 1674183
Operon:

Trans-membrane region:
Role: I.H.1 - Synthesis of fatty and mycolic acids
GO terms:
- GO:0102132 - 3-oxo-pimeloyl-[acp] methyl ester reductase activity (Uniprot)
- GO:0102131 - 3-oxo-glutaryl-[acp] methyl ester reductase activity (Uniprot)
- GO:0071768 - mycolic acid biosynthetic process (Uniprot)
- GO:0070402 - NADPH binding (Uniprot)
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0046459 - short-chain fatty acid metabolic process (Uniprot)
- GO:0018454 - acetoacetyl-CoA reductase activity (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0006633 - fatty acid biosynthetic process (Uniprot)
- GO:0006631 - fatty acid metabolic process (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005515 - protein binding (Uniprot)
- GO:0004316 - 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3lls, 2ntn, 1uzn, 1uzm, 1uzl
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
1UZL	99%	MYCOBACTERIUM TUBERCULOSIS	MabA from Mycobacterium tuberculosis
1UZN	98%	MYCOBACTERIUM TUBERCULOSIS	MabA from Mycobacterium tuberculosis
1UZM	98%	MYCOBACTERIUM TUBERCULOSIS	MabA from Mycobacterium tuberculosis
2NTN	98%	Mycobacterium tuberculosis H37Rv	Crystal structure of MabA-C60V/G139A/S144L
5OVL	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	crystal structure of MabA bound to NADP+ from M. smegmatis
5OVK	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure MabA bound to NADPH from M. smegmatis
5OVJ	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structure of the apo form of Mycobacterium smegmatis MabA
2NM0	57%	Streptomyces coelicolor	Crystal Structure of SCO1815: a Beta-Ketoacyl-Acyl Carrier Protein Reductase from Streptomyces coelicolor A3(2)
3WOH	44%	Streptomyces	Structure of Ketoreductase SiaM from Streptomyces sp. A7248
1Q7B	44%	Escherichia coli	The structure of betaketoacyl-[ACP] reductase from E. coli in complex with NADP+

Links to additional information on fabG1:
- KEGG - nucleotide and amino acid sequences of gene
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -11.068 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VTATATEGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRM
TEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQ
GALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH

(Nucleotide sequence available on KEGG)

Additional Information

aka MabA

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.998900; 13 non-insertions in a row out of 13 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999950; 13 non-insertions in a row out of 13 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999950; 13 non-insertions in a row out of 13 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 13 non-insertions in a row out of 13 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 13 non-insertions in a row out of 13 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.79
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0818 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0818 (-)

Property	Value	Creator	Evidence	PMID	Comment
Name	-Ketoacyl-ACP reductase/3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE	mjackson	IMP		FAS-II
Name	-Ketoacyl-ACP reductase/3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE	mjackson	IDA		FAS-II
Citation	Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005	jjmcfadden		15653820	Inferred from direct assay
Term	EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR	jjmcfadden	NR		Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NR	jjmcfadden	NR		Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase. - NR	jjmcfadden	NR		Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005

TB Genome Annotation Portal