TB Genome Annotation Portal

Rv1477 (ripA)

Amino Acid Sequence

MRRNRRGSPARPAARFVRPAIPSALSVALLVCTPGLATADPQTDTIAALIADVAKANQRLQDLSDEVQAEQESVNKAMVDVETARDNAAAAEDDLEVSQR
AVKDANAAIAAAQHRFDTFAAATYMNGPSVSYLSASSPDEIIATVTAAKTLSASSQAVMANLQRARTERVNTESAARLAKQKADKAAADAKASQDAAVAA
LTETRRKFDEQREEVQRLAAERDAAQARLQAARLVAWSSEGGQGAPPFRMWDPGSGPAGGRAWDGLWDPTLPMIPSANIPGDPIAVVNQVLGISATSAQV
TANMGRKFLEQLGILQPTDTGITNAPAGSAQGRIPRVYGRQASEYVIRRGMSQIGVPYSWGGGNAAGPSKGIDSGAGTVGFDCSGLVLYSFAGVGIKLPH
YSGSQYNLGRKIPSSQMRRGDVIFYGPNGSQHVTIYLGNGQMLEAPDVGLKVRVAPVRTAGMTPYVVRYIEY
(Nucleotide sequence available on KEGG)

Additional Information

activated by MarP during acid stress:
Botella et al. (2017). Mycobacterium tuberculosis protease MarP activates a peptidoglycan hydrolase during acid stress. EMBO J. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5437814/

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1477/ripA, gene len: 1418 bp, num TA sites: 25
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiodomain essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.13)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.34)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.76 (0.36)0.89 (0.38)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1477 (ripA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2450csinghpankaj2116IMPCo-expression (Functional linkage)
    BD. Kana, BG. Gordhan et al. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv2450csinghpankaj2116IMPCo-expression (Functional linkage)
    EC. Hett, MC. Chao et al. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Mol. Microbiol. 2007
    InteractionPhysicalInteraction Rv2450csinghpankaj2116IMPCo-expression (Functional linkage)
    authors,GV. Mukamolova,AS. Kaprelyants,DI. Young,M. Young,DB. Kell A bacterial cytokine. Proc. Natl. Acad. Sci. U.S.A. 1998
    InteractionPhysicalInteraction Rv2450crichasinha4uIDAYeast two-hybrid (Physical interaction)
    KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
    InteractionPhysicalInteraction Rv2450crichasinha4uIDAYeast two-hybrid (Physical interaction)
    BD. Kana, BG. Gordhan et al. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv2450crichasinha4uIDAYeast two-hybrid (Physical interaction)
    authors,JM. Tufariello,WR. Jacobs,J. Chan Individual Mycobacterium tuberculosis resuscitation-promoting factor homologues are dispensable for growth in vitro and in vivo. Infect. Immun. 2004
    InteractionPhysicalInteraction Rv2450crichasinha4uIDAYeast two-hybrid (Physical interaction)
    EC. Hett, MC. Chao et al. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Mol. Microbiol. 2007
    CitationA partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. EC. Hett, MC. Chao et al. Mol. Microbiol. 2007vijayachitraIPI17919286Yeast two-hybrid (Physical interaction)
    InteractionActivates Rv1009vijayachitraIPIYeast two-hybrid (Physical interaction)
    EC. Hett, MC. Chao et al. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Mol. Microbiol. 2007
    InteractionActivates Rv2450cvijayachitraIPIYeast two-hybrid (Physical interaction)
    EC. Hett, MC. Chao et al. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Mol. Microbiol. 2007
    InteractionPhysicalInteraction Rv1009harsharohiratruefriendIPIyeast two hybrid
    EC. Hett, MC. Chao et al. A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis. Mol. Microbiol. 2007
    InteractionPhysicalInteraction Rv1009harsharohiratruefriendIPIyeast two hybrid
    BD. Kana, BG. Gordhan et al. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1009harsharohiratruefriendIPIyeast two hybrid
    JM. Tufariello, K. Mi et al. Deletion of the Mycobacterium tuberculosis resuscitation-promoting factor Rv1009 gene results in delayed reactivation from chronic tuberculosis. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv1009harsharohiratruefriendIPIyeast two hybrid
    KJ. Downing, VV. Mischenko et al. Mutants of Mycobacterium tuberculosis lacking three of the five rpf-like genes are defective for growth in vivo and for resuscitation in vitro. Infect. Immun. 2005
    InteractionPhysicalInteraction Rv0867cgirishgene07IPIAffinity purification (Physical interaction)
    BD. Kana, BG. Gordhan et al. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv0867cgirishgene07IPIAffinity purification (Physical interaction)
    EC. Hett, MC. Chao et al. A mycobacterial enzyme essential for cell division synergizes with resuscitation-promoting factor. PLoS Pathog. 2008
    InteractionPhysicalInteraction Rv0867cgirishgene07IPIAffinity purification (Physical interaction)
    S. Bardarov, S. Bardarov Jr et al. Specialized transduction: an efficient method for generating marked and unmarked targeted gene disruptions in Mycobacterium tuberculosis, M. bovis BCG and M. smegmatis. Microbiology (Reading, Engl.) 2002
    SymbolripAmjacksonIDAPeptidoglycan turnover
    NamePeptidoglycan hydrolase (L,D-peptidase, NLP/P60 family member)mjacksonIDAPeptidoglycan turnover

    Comments