Rv1465 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: NifU family SUF system FeS assembly protein
- REFSEQ: nitrogen fixation related protein
- PATRIC: Putative iron-sulfur cluster assembly scaffold protein for SUF system SufE2
- TUBERCULIST: Possible nitrogen fixation related protein
- NCBI: Possible nitrogen fixation related protein
- updated information (H37Rv4):
  - gene name: sufU/nifU/iscU
  - function: assembly of iron-sulfur clusters
  - reference: (Huet 2005, PMID: 16109955)
Type: Essential
Start: 1652768
End: 1653256
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0097428 - protein maturation by iron-sulfur cluster transfer (Uniprot)
- GO:0051539 - 4 iron, 4 sulfur cluster binding (Uniprot)
- GO:0051537 - 2 iron, 2 sulfur cluster binding (Uniprot)
- GO:0051536 - iron-sulfur cluster binding (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0036455 - iron-sulfur transferase activity (Uniprot)
- GO:0016226 - iron-sulfur cluster assembly (Uniprot)
- GO:0008198 - ferrous iron binding (Uniprot)
- GO:0006879 - cellular iron ion homeostasis (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005506 - iron ion binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2QQ4	42%	Thermus thermophilus	Crystal structure of Iron-sulfur cluster biosynthesis protein IscU (TTHA1736) from thermus thermophilus HB8
6JZW	39%	Bacillus subtilis (strain 168)	Crystal structure of SufU from Bacillus subtilis with Cys persulfurated
6JZW	39%	Bacillus subtilis (strain 168)	Crystal structure of SufU from Bacillus subtilis with Cys persulfurated
6JZV	39%	Bacillus subtilis (strain 168)	Crystal structure of SufU from Bacillus subtilis
5XT6	39%	Bacillus subtilis (strain 168)	A sulfur-transferring catalytic intermediate of SufS-SufU complex from Bacillus subtilis
5XT6	39%	Bacillus subtilis (strain 168)	A sulfur-transferring catalytic intermediate of SufS-SufU complex from Bacillus subtilis
5XT5	39%	Bacillus subtilis (strain 168)	SufS-SufU complex from Bacillus subtilis
2AZH	39%	Bacillus subtilis	Solution structure of iron-sulfur cluster assembly protein SUFU from Bacillus subtilis, with zinc bound at the active site. Northeast Structural Genomics Consortium target SR17
1XJS	39%	Bacillus subtilis	Solution structure of Iron-Sulfur cluster assembly protein IscU from Bacillus subtilis, with Zinc bound at the active site. Northeast Structural Genomics Consortium Target SR17
6A6G	38%	Fervidobacterium islandicum	Crystal structure of thermostable FiSufS-SufU complex from thermophilic Fervidobacterium Islandicum AW-1

Links to additional information on Rv1465:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -1.442 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- Photo of spot titer

Amino Acid Sequence

VTLRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVALSEDGTRVTDVSYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMV
SSRGTVPGDEDVLGDGVAFAGVAKYPARVKCALLGWMAFKDALAQASEAFEEVTDERNQRTG

(Nucleotide sequence available on KEGG)

Additional Information

sufU or nifU or iscU - assembly of iron-sulfur clusters.

Huet G, Daffé M, Saves I. Identification of the Mycobacterium
tuberculosis SUF machinery as the exclusive mycobacterial system of
[Fe-S] cluster assembly: evidence for its implication in the
pathogen's survival. J Bacteriol. 2005 Sep;187(17):6137-46. doi:
10.1128/JB.187.17.6137-6146.2005. PMID: 16109955; PMCID: PMC1196142.

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.976950; 8 non-insertions in a row out of 8 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.418350; 5 non-insertions in a row out of 8 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.997800; 8 non-insertions in a row out of 8 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.984750; 7 non-insertions in a row out of 8 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.984300; 7 non-insertions in a row out of 8 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.16
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1460 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0691c (-) (Upstream of operon)
- Rv1033c (trcR) (Upstream of operon)
- Rv1460 (-) (Upstream of operon)
- Rv2610c (pimA) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv1460 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	GlbN (cyanoglobin) is a peripheral membrane protein that is restricted to certain Nostoc spp. authors,DR. Hill,TJ. Belbin,MV. Thorsteinsson,D. Bassam,S. Brass,A. Ernst,P. Bger,H. Paerl,ME. Mulligan,M. Potts J. Bacteriol. 1996	priti.priety	IEP	8932316	Co-expression (Functional linkage)
Interaction	PhysicalInteraction Rv1542c	priti.priety	IEP		Co-expression (Functional linkage) authors,DR. Hill,TJ. Belbin,MV. Thorsteinsson,D. Bassam,S. Brass,A. Ernst,P. Bger,H. Paerl,ME. Mulligan,M. Potts GlbN (cyanoglobin) is a peripheral membrane protein that is restricted to certain Nostoc spp. J. Bacteriol. 1996
Citation	GlbN (cyanoglobin) is a peripheral membrane protein that is restricted to certain Nostoc spp. authors,DR. Hill,TJ. Belbin,MV. Thorsteinsson,D. Bassam,S. Brass,A. Ernst,P. Bger,H. Paerl,ME. Mulligan,M. Potts J. Bacteriol. 1996	ashwinigbhat	IEP	8932316	Co-expression (Functional linkage)
Interaction	PhysicalInteraction Rv1542c	ashwinigbhat	IEP		Co-expression (Functional linkage) authors,DR. Hill,TJ. Belbin,MV. Thorsteinsson,D. Bassam,S. Brass,A. Ernst,P. Bger,H. Paerl,ME. Mulligan,M. Potts GlbN (cyanoglobin) is a peripheral membrane protein that is restricted to certain Nostoc spp. J. Bacteriol. 1996
Interaction	RegulatedBy Rv3557c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1931c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0818	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0260c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

TB Genome Annotation Portal