TB Genome Annotation Portal

Rv1463 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: FeS assembly ATPase SufC
  • REFSEQ: ABC transporter ATP-binding protein
  • PATRIC: Iron-sulfur cluster assembly ATPase protein SufC
  • TUBERCULIST: Probable conserved ATP-binding protein ABC transporter
  • NCBI: Probable conserved ATP-binding protein ABC transporter
  • updated information (H37Rv4):
    • gene name: sufC
    • function: assembly of iron-sulfur clusters
    • reference: (Huet 2005, PMID: 16109955)
• Type: Essential
• Start: 1650716
• End: 1651516
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2D2F	55%	Thermus thermophilus	Crystal structure of atypical cytoplasmic ABC-ATPase SufC from Thermus thermophilus HB8
  2D2E	55%	Thermus thermophilus	Crystal structure of atypical cytoplasmic ABC-ATPase SufC from Thermus thermophilus HB8
  5AWG	50%	Escherichia coli (strain K12)	Crystal structure of Hg-bound SufB-SufC-SufD complex from Escherichia coli
  5AWF	50%	Escherichia coli (strain K12)	Crystal structure of SufB-SufC-SufD complex from Escherichia coli
  2ZU0	50%	Escherichia coli	Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis
  2D3W	50%	Escherichia coli	Crystal Structure of Escherichia coli SufC, an ATPase compenent of the SUF iron-sulfur cluster assembly machinery
  6JBH	50%	Alicyclobacillus herbarius	Cryo-EM structure and transport mechanism of a wall teichoic acid ABC transporter

• Links to additional information on Rv1463:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -9.298 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • Photo of spot titer

Amino Acid Sequence

MTILEIKDLHVSVENPAEADHEIPILRGVDLTVKSGETHALMGPNGSGKSTLSYAIAGHPKYHVTSGTITLDGADVLAMSIDERARAGLFLAMQYPVEVP
GVSMSNFLRSAATAIRGEPPKLRHWVKEVKAAMAALDIDPAFAERSVNEGFSGGEKKRHEILQLELLKPKIAILDETDSGLDVDALRVVSEGVNRYAESQ
HGGILLITHYTRILRYIHPEYVHVFVGGRIVESGGSELADELDQNGYVRFSPASGRYPHQPAPTGA

Additional Information

sufC - assembly of iron-sulfur clusters.

Huet G, Daffé M, Saves I. Identification of the Mycobacterium
tuberculosis SUF machinery as the exclusive mycobacterial system of
[Fe-S] cluster assembly: evidence for its implication in the
pathogen's survival. J Bacteriol. 2005 Sep;187(17):6137-46. doi:
10.1128/JB.187.17.6137-6146.2005. PMID: 16109955; PMCID: PMC1196142.

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.51 (0.23)	1.11 (0.33)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link