TB Genome Annotation Portal

Rv1458c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: antibiotic transporter ATP-binding protein
  • REFSEQ: unidentified antibiotic-transport ATP-binding protein ABC transporter
  • PATRIC: ABC-type multidrug transport system ATPase component
  • TUBERCULIST: Probable unidentified antibiotic-transport ATP-binding protein ABC transporter
  • NCBI: Probable unidentified antibiotic-transport ATP-binding protein ABC transporter
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1643319
• End: 1644260
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6PZI	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell SUR1 bound to ATP only
  6PZC	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell SUR1 bound to carbamazepine
  6PZB	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell SUR1 Apo state
  6PZA	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell SUR1 bound to ATP and glibenclamide
  6PZ9	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell SUR1 bound to ATP and repaglinide
  6JB3	36%	Mesocricetus auratus	Structure of SUR1 subunit bound with repaglinide
  6JB1	36%	Mesocricetus auratus	Structure of pancreatic ATP-sensitive potassium channel bound with repaglinide and ATPgammaS at 3.3A resolution
  6C3P	36%	Homo sapiens	Cryo-EM structure of human KATP bound to ATP and ADP in propeller form
  6C3O	36%	Homo sapiens	Cryo-EM structure of human KATP bound to ATP and ADP in quatrefoil form
  6BAA	36%	Cricetus cricetus	Cryo-EM structure of the pancreatic beta-cell KATP channel bound to ATP and glibenclamide

• Links to additional information on Rv1458c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -1.803 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VNRAPDTPEVVLRLRGVCKRYGSITAVSNLDLDVHDAEVMALLGPNGAGKTTTVEMCEGFVRPDAGSIEVLGLDPITDNARLRARIGVMLQGGGGYPAAR
AGEMLDLVASYAANPLDPHWLLDTLGLTEAARTTYRRLSGGQQQRLALACALVGRPQLVFLDEPTAGMDAHARVLVWELIDALRRDGVTVVLTTHHLKEA
EELADRLVIIDHGVTVAAGTPAELMRSGAKDQLRFTAPPRLDLSLLASALPEGYQATELTPGEYLVEGPVDPQVLATVTAWCAQIDVLATDMRVEQRSLE
DVFLDLTGRKLRQ

Additional Information