TB Genome Annotation Portal

Rv1457c (-)

Amino Acid Sequence

VTQTNRPAFPAGTFSPDPRPNAVPLMLAAQFSLELKLLLRNGEQLLLTMFIPITLLVGLTLLPMGSFGHNRAATFVPVIMALAVISTAFTGQAIAVAFDR
RYGALKRLGATPLPVWGIIAGKSLAVVAVVFLQAIILGAIGFALGWRPALTALTLGAGIIALGTAGFAALGLLLGGTLRAEIVLAVANLMWFVFAGFGAL
TLESNVIPTAFKWVARVTPSGALTEALSQAMTVSVDWFGIVVLAVWGALAALAALRWFRFT
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.965200;
8 non-insertions in a row out of 8 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.995550;
8 non-insertions in a row out of 8 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.995600;
8 non-insertions in a row out of 8 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.992800;
8 non-insertions in a row out of 8 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.992000;
8 non-insertions in a row out of 8 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.2
Growth-Defect 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1457c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    CitationIdentification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. AK. Mishra, LJ. Alderwick et al. Mol. Microbiol. 2008ashwinigbhatTAS18452585Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    CitationThe glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan Glycobiology 2007ashwinigbhatTAS17261566Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    CitationThe glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan Glycobiology 2007priti.prietyTAS17261566Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    CitationThree monophyletic superfamilies account for the majority of the known glycosyltransferases. authors,J. Liu,A. Mushegian Protein Sci. 2003ashwinigbhatTAS12824488Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    CitationThree monophyletic superfamilies account for the majority of the known glycosyltransferases. authors,J. Liu,A. Mushegian Protein Sci. 2003priti.prietyTAS12824488Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    CitationIdentification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. AK. Mishra, LJ. Alderwick et al. Mol. Microbiol. 2008priti.prietyTAS18452585Operon (Functional linkage)
    InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    authors,D. Kaur,ME. Guerin,H. Skovierov,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
    InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
    InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003

    Comments