TB Genome Annotation Portal

Rv1457c (-)

Amino Acid Sequence

VTQTNRPAFPAGTFSPDPRPNAVPLMLAAQFSLELKLLLRNGEQLLLTMFIPITLLVGLTLLPMGSFGHNRAATFVPVIMALAVISTAFTGQAIAVAFDR
RYGALKRLGATPLPVWGIIAGKSLAVVAVVFLQAIILGAIGFALGWRPALTALTLGAGIIALGTAGFAALGLLLGGTLRAEIVLAVANLMWFVFAGFGAL
TLESNVIPTAFKWVARVTPSGALTEALSQAMTVSVDWFGIVVLAVWGALAALAALRWFRFT
(Nucleotide sequence available on KEGG)

Additional Information
















Analysis of Positive Selection in Clinical Isolates
*new*






Moldova (2,057)global set (5,195)

under significant positive selection?NOYES

omega peak height (95%CI lower bound)1.45 (0.13)2.77 (1.17)

codons under selection199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213

omega plots

genetic variants*linklink

statistics at each codonlinklink



* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"











    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1457c/-,
gene len: 785 bp, num TA sites: 8



conditiondatasetcallmediummethodnotes

in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined

in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2

in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)

in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05

in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05

differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol

in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice

in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM

in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)

differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.22)YM rich vs minimal mediumresampling







    












 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
    Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.




    Interactions based on ChIPSeq data
    

    
    

    
    
    

    • 

      
    
    • Binds To:
      
    
        

            
      •  No bindings to other targets were found.

    
      
    
      • 
    
    • Bound By:
      
    
    
      • 

    





    Interactions based on ChIPSeq data (Minch et al. 2014)
    

      

    
    • Binds To:
      
    
        

            
      •  No bindings to other targets were found.

    
      
    
      • 

    
    • Bound By:
      
    
    
      • 

    



    Interactions based on TFOE data (Rustad et al. 2014)
    






      
    
    • Upregulates:
      
    
        

        
      •  Does not upregulate other genes.

    
      

    
    • Upregulated by:
      
    
        

        
      •  Not upregulated by other genes.

    
      


    
    • Downregulates:
      
    
        

        
      •  Does not downregulate other genes.

    
      

    
    • Downregulated by:
      
    


    








    

    






    


    


    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv1457c (-)

    

    PropertyValueCreatorEvidencePMIDComment
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
CitationIdentification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. AK. Mishra, LJ. Alderwick et al. Mol. Microbiol. 2008ashwinigbhatTAS18452585Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1459cashwinigbhatTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
CitationThe glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan Glycobiology 2007ashwinigbhatTAS17261566Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
CitationThe glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan Glycobiology 2007priti.prietyTAS17261566Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
    
CitationThree monophyletic superfamilies account for the majority of the known glycosyltransferases. authors,J. Liu,A. Mushegian Protein Sci. 2003ashwinigbhatTAS12824488Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
InteractionPhysicalInteraction Rv1458cashwinigbhatTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
CitationThree monophyletic superfamilies account for the majority of the known glycosyltransferases. authors,J. Liu,A. Mushegian Protein Sci. 2003priti.prietyTAS12824488Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
InteractionPhysicalInteraction Rv1459cpriti.prietyTASOperon (Functional linkage)
    authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
    
CitationIdentification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. AK. Mishra, LJ. Alderwick et al. Mol. Microbiol. 2008priti.prietyTAS18452585Operon (Functional linkage)
    
InteractionPhysicalInteraction Rv1456cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1458cpriti.prietyTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    
InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    authors,D. Kaur,ME. Guerin,H. Skovierov,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
    
InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
    
InteractionPhysicalInteraction Rv1456chibeeluckTASOperon (Functional linkage)
    AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
    
InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    
InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    

    


    Comments