TB Genome Annotation Portal

Rv1446c (opcA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: opcA protein
  • REFSEQ: putative OXPP cycle protein OPCA
  • PATRIC: OpcA an allosteric effector of glucose-6-phosphate dehydrogenase actinobacterial
  • TUBERCULIST: Putative OXPP cycle protein OpcA
  • NCBI: Putative OXPP cycle protein OpcA
  • updated information (H37Rv4):
    • gene name: opcA
    • function:
    • reference:
• Type: Not Target
• Start: 1624454
• End: 1625365
• Operon:


• Trans-membrane region:
  
• Role: I.B.5 - Pentose phosphate pathway
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on opcA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.173 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MIVDLPDTTTTAVNKKLDELREKIGAVAMGRVLTLIIAPDSEAMLEESIEAANDASHEHPSRIIVTMRGDPYADRPRLDAQLRVGADAGAGEFVVLRLSG
PLAGHADSVVIPFLLPDIPVVAWWPDIAPAVPAQDALGKLAIRRITDATNAIDPLSAIKSRLAGYGAGDTDLAWSRITYWRALLTSAVDQPRHEPIESAL
VSGLKTEPALDVLAGWLASRIEGPVRRAVGELKVELVRNSETIVLSRPQEGITATLTRTGKPDALVPLARRVTGECLAEDLRRLDPDEIYCAALEGIKKV
QYR

Additional Information