Rv1402 (priA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: primosomal protein N'
- REFSEQ: primosome assembly protein PriA
- PATRIC: Helicase PriA essential for oriC/DnaA-independent DNA replication
- TUBERCULIST: Putative primosomal protein N' PriA (replication factor Y)
- NCBI: Putative primosomal protein N' PriA (replication factor Y)
- updated information (H37Rv4):
  - gene name: priA
  - function:
  - reference:
Type: Not Target
Start: 1577613
End: 1579580
Operon:

Trans-membrane region:
Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
GO terms:
- GO:1990077 - primosome complex (Uniprot)
- GO:0046872 - metal ion binding (Uniprot)
- GO:0043140 - ATP-dependent 3'-5' DNA helicase activity (Uniprot)
- GO:0032508 - DNA duplex unwinding (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0006310 - DNA recombination (Uniprot)
- GO:0006302 - double-strand break repair (Uniprot)
- GO:0006270 - DNA replication initiation (Uniprot)
- GO:0006269 - DNA replication, synthesis of RNA primer (Uniprot)
- GO:0006268 - DNA unwinding involved in DNA replication (Uniprot)
- GO:0006260 - DNA replication (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0004386 - helicase activity (Uniprot)
- GO:0004003 - ATP-dependent DNA helicase activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on priA:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -4.39 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MLSVPHLDRDFDYLVPAEHSDDAQPGVRVRVRFHGRLVDGFVLERRSDSDHHGKLGWLDRVVSPEPVLTTEIRRLVDAVAARYAGTRQDVLRLAVPARHA
RVEREITTAPGRPVVAPVDPSGWAAYGRGRQFLAALADSRAARAVWQALPGELWADRFAEAAAQTVRAGRTVLAIVPDQRDLDTLWQAATALVDEHSVVA
LSAGLGPEARYRRWLAALRGSARLVIGTRSAVFAPLSELGLVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGGYARTAEAHALVRSGWAHDV
VAPRPEVRARSPRVVALDDSGYDDARDPAARTARLPSIALRAARSALQSGAPVLVQVPRRGYIPSLACGRCRAIARCRSCTGPLSLQGAGSPGAVCRWCG
RVDPTLRCVRCGSDVVRAVVVGARRTAEELGRAFPGTAVITSAGDTLVPQLDAGPALVVATPGAEPRAPGGYGAALLLDSWALLGRQDLRAAEDALWRWM
TAAALVRPRGAGGVVTVVAESSIPTVQSLIRWDPVGHAEAELAARTEVGLPPSVHIAALDGPAGTVTALLEAARLPDPDRLQADLLGPVDLPPGVRRPAG
IPADAPVIRMLLRVCREQGLELAASLRRGIGVLSARQTRQTRSLVRVQIDPLHIG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 27 non-insertions in a row out of 27 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 23 non-insertions in a row out of 27 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 27 non-insertions in a row out of 27 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 27 non-insertions in a row out of 28 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 27 non-insertions in a row out of 28 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.41
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3849 (espR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0260c (-)
- Rv3416 (whiB3)
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	Comment
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2973c	shahanup86	ISS	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001

TB Genome Annotation Portal