TB Genome Annotation Portal

Rv1373 (-)

Amino Acid Sequence

MNSEHPMTDRVVYRSLMADNLRWDALQLRDGDIIISAPSKSGLTWTQRLVSLLVFDGPDLPGPLSTVSPWLDQTIRPIEEVVATLDAQQHRRFIKTHTPL
DGLVLDDRVSYICVGRDPRDAAVSMLYQSANMNEDRMRILHEAVVPFHERIAPPFAELGHARSPTEEFRDWMEGPNQPPPGIGFTHLKGIGTLANILHQL
GTVWVRRHLPNVALFHYADYQADLAGELLRPARVLGIAATRDRARDLAQYATLDAMRSRASEIAPNTTDGIWHSDERFFRRGGSGDWQQFFTEAEHLRYY
HRINQLAPPDLLAWAHEGRRGYDPAN
(Nucleotide sequence available on KEGG)

Additional Information

sft2

Mougous...Bertozzi (2004) NSMB
http://www.nature.com/nsmb/journal/v11/n8/full/nsmb802.html

Sulfotransferases and Sulfatases in Mycobacteria
http://www.sciencedirect.com/science/article/pii/S1074552102001758

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 19 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 19 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 19 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 19 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 19 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.49
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.

    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.

    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.

    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv1373 (-)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:TRESULT trehalose sulfotransferase - IDAnjamshidiIDA15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    CA. Rivera-Marrero, JD. Ritzenthaler et al. Molecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2002
    CitationIdentification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Nat. Struct. Mol. Biol. 2004njamshidiISS15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    TermEC:2.8.2.2 Alcohol sulfotransferase. - ISSnjamshidiISS15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Identification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. Nat. Struct. Mol. Biol. 2004
    TermTBRXN:TRESULT trehalose sulfotransferase - ISSnjamshidiISS15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Identification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. Nat. Struct. Mol. Biol. 2004
    CitationMolecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. CA. Rivera-Marrero, JD. Ritzenthaler et al. Microbiology (Reading, Engl.) 2002njamshidiISS11882713|15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    TermEC:2.8.2.2 Alcohol sulfotransferase. - ISSnjamshidiISS15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    CA. Rivera-Marrero, JD. Ritzenthaler et al. Molecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2002
    TermTBRXN:TRESULT trehalose sulfotransferase - ISSnjamshidiISS15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    CA. Rivera-Marrero, JD. Ritzenthaler et al. Molecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2002
    CitationIdentification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Nat. Struct. Mol. Biol. 2004njamshidiIDA15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    TermEC:2.8.2.2 Alcohol sulfotransferase. - IDAnjamshidiIDA15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Identification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. Nat. Struct. Mol. Biol. 2004
    TermTBRXN:TRESULT trehalose sulfotransferase - IDAnjamshidiIDA15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    authors,JD. Mougous,CJ. Petzold,RH. Senaratne,DH. Lee,DL. Akey,FL. Lin,SE. Munchel,MR. Pratt,LW. Riley,JA. Leary,JM. Berger,CR. Bertozzi Identification, function and structure of the mycobacterial sulfotransferase that initiates sulfolipid-1 biosynthesis. Nat. Struct. Mol. Biol. 2004
    CitationMolecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. CA. Rivera-Marrero, JD. Ritzenthaler et al. Microbiology (Reading, Engl.) 2002njamshidiIDA11882713|15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    TermEC:2.8.2.2 Alcohol sulfotransferase. - IDAnjamshidiIDA15258569PMID: 15258569 show biochemically that paps is the sulfate donor. see also PMID: 11882713
    CA. Rivera-Marrero, JD. Ritzenthaler et al. Molecular cloning and expression of a novel glycolipid sulfotransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2002

    Comments