Rv1355c (moeY)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: molybdopterin biosynthesis protein moeY
- REFSEQ: hypothetical protein
- PATRIC: Molybdopterin biosynthesis protein MoeY
- TUBERCULIST: Possible molybdopterin biosynthesis protein MoeY
- NCBI: Possible molybdopterin biosynthesis protein MoeY
- updated information (H37Rv4):
  - gene name: moeY
  - function:
  - reference:
Type: Essential
Start: 1521885
End: 1524032
Operon:

Trans-membrane region:
Role: I.G.4 - Molybdopterin
GO terms:
- GO:0061504 - cyclic threonylcarbamoyladenosine biosynthetic process (Uniprot)
- GO:0061503 - tRNA threonylcarbamoyladenosine dehydratase (Uniprot)
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0008641 - ubiquitin-like modifier activating enzyme activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on moeY:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.27 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology

Amino Acid Sequence

VTIPHEGGSTGILVLRDDDHDDVLVLDRLRSDPSIEFVDRFAEQLAGVRRLLPQPDPDLLEEAKRWAYYPWRRMVVAILGLRGFRAVRLDRNRHLITAEE
QRALHALRVGVVGLSAGHAIAYTLAAEGACGTLRLADFDKIELSNLNRVPVGVFDIGLNKAMIAARRIAELDPYLAVDLVTSGLSPESVDEFLDGLDVVI
EECDSLDIKVILRQAACARGVPVLMATSDRGLVDVERYDVEPGRPIFHGLLGDIDADKLCGLTTKDKVPHVLNILDCQELSARCAASMIEVDQTLWGWPQ
LAGDIWVGAATVAEAVRRIGLGEPLESGRVRVDVSAALDRLDQPPMPSRGNGWLLESVPPTAPAEPQPTSEIVAQAAIRAPSGGNVQPWHVVAKQHSLTI
RLAPEHTSAMDIAFRGSAVAVGAAMFNARVAAAAHRVLGSVEFDESQPDSPLQATMHFGRGDDPSLAALYRPMLLRTTNRHHGMPGHVHPATVELLTNTA
AAEGARLQLLLSRNEIDRAATILAAADRIRYLTPRLHEEMMSELRWPGDPSLDAGIDVRSLELDSGELRVLDILRRSDVVARLAQWDCGTALEDNTNERV
SASSALAIVYVDGATLTDFARGGSAMQAVWIVAQQHGLAVQPMSPIFLYARGRHDLDQASPHFAAQLHRLQLDFRELVKPGKEGHEVLIFRLFHAPPPSV
CSRRRVRHAIPEPHR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999900; 19 non-insertions in a row out of 40 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.997350; 12 non-insertions in a row out of 40 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.998650; 12 non-insertions in a row out of 40 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.909050; 9 non-insertions in a row out of 41 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.901100; 9 non-insertions in a row out of 41 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0324 (-) (Upstream of operon)
- Rv0465c (-) (Upstream of operon)
- Rv1994c (cmtR) (Upstream of operon)
- Rv2989 (-) (Upstream of operon)
- Rv3574 (kstR) (Upstream of operon)
- Rv3849 (espR) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. T. Parish, DA. Smith et al. Microbiology (Reading, Engl.) 2003	swetha.r	IEP	12777483	Co-expression (Functional linkage)
Interaction	Regulatory Rv0490	swetha.r	IEP		Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv0491	swetha.r	IEP		Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Citation	Genetic characterization of Mycobacterium tuberculosis clinical isolates with deletions in the plcA-plcB-plcC locus. L. Vera-Cabrera, CA. Molina-Torres et al. Tuberculosis (Edinburgh, Scotland) 2007	swetha.r	IEP	16704934	Co-expression (Functional linkage)
Interaction	Regulatory Rv0490	swetha.r	IEP		Co-expression (Functional linkage) L. Vera-Cabrera, CA. Molina-Torres et al. Genetic characterization of Mycobacterium tuberculosis clinical isolates with deletions in the plcA-plcB-plcC locus. Tuberculosis (Edinburgh, Scotland) 2007
Interaction	Regulatory Rv0491	swetha.r	IEP		Co-expression (Functional linkage) L. Vera-Cabrera, CA. Molina-Torres et al. Genetic characterization of Mycobacterium tuberculosis clinical isolates with deletions in the plcA-plcB-plcC locus. Tuberculosis (Edinburgh, Scotland) 2007
Interaction	Regulatory Rv0616c	akankshajain.21	IEP		Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003

TB Genome Annotation Portal