TB Genome Annotation Portal

Rv1348 (irtA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: iron import ATP-binding/permease IrtA
  • REFSEQ: drugs-transport transmembrane ATP-binding protein ABC transporter
  • PATRIC: ABC transporter ATP-binding protein
  • TUBERCULIST: Iron-regulated transporter IrtA
  • NCBI: Iron-regulated transporter IrtA
  • updated information (H37Rv4):
    • gene name: irtA
    • function:
    • reference:
• Type: Essential
• Start: 1513047
• End: 1515626
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0075139 - response to host iron concentration (Uniprot)
  • GO:0071949 - FAD binding (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0055085 - transmembrane transport (Uniprot)
  • GO:0055072 - iron ion homeostasis (Uniprot)
  • GO:0052099 - acquisition by symbiont of nutrients from host via siderophores (Uniprot)
  • GO:0044718 - siderophore transmembrane transport (Uniprot)
  • GO:0042626 - ATPase activity, coupled to transmembrane movement of substances (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0033216 - ferric iron import (Uniprot)
  • GO:0033214 - iron assimilation by chelation and transport (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015891 - siderophore transport (Uniprot)
  • GO:0015343 - siderophore transmembrane transporter activity (Uniprot)
  • GO:0010106 - cellular response to iron ion starvation (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 0.48 ATP[c] + 0.48 TREHALOSEMONOMYCOLATE_40_CY_41_[c] -> 0.48 ADP[c] + 0.48 PI[c] + TREHALOSEMONOMYCOLATE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6TEK	71%	Mycolicibacterium thermoresistibile	Structure of siderophore interaction domain of IrtAB
  6TEJ	70%	Mycolicibacterium thermoresistibile	Structure of apo IrtAB devoid SID in complex with sybody Syb_NL5
  4A82	47%	HOMO SAPIENS	Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.
  2ONJ	47%	Staphylococcus aureus	Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP
  2HYD	47%	Staphylococcus aureus	Multidrug ABC transporter SAV1866
  5IDV	47%	Acinetobacter baumannii AB5075	Structure of the nucleotide binding domain of an ABC transporter MsbA from Acinetobacter baumannii
  5EUM	46%	Haemophilus influenzae PittII	1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
  5DGX	45%	Francisella tularensis subsp. tularensis (strain FSC 198)	1.73 Angstrom resolution crystal structure of the ABC-ATPase domain (residues 357-609) of lipid A transport protein (msbA) from Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
  6UJP	43%	Mus musculus	P-glycoprotein mutant-F979A and C952A-with BDE100
  4Q7M	42%	Thermotoga maritima	Structure of NBD288-Avi of TM287/288

• Links to additional information on irtA:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -4.742 (from Jeremy Rock's lab)

Amino Acid Sequence

MARGLQGVMLRSFGARDHTATVIETISIAPHFVRVRMVSPTLFQDAEAEPAAWLRFWFPDPNGSNTEFQRAYTISEADPAAGRFAVDVVLHDPAGPASSW
ARTVKPGATIAVMSLMGSSRFDVPEEQPAGYLLIGDSASIPGMNGIIETVPNDVPIEMYLEQHDDNDTLIPLAKHPRLRVRWVMRRDEKSLAEAIENRDW
SDWYAWATPEAAALKCVRVRLRDEFGFPKSEIHAQAYWNAGRAMGTHRATEPAATEPEVGAAPQPESAVPAPARGSWRAQAASRLLAPLKLPLVLSGVLA
ALVTLAQLAPFVLLVELSRLLVSGAGAHRLFTVGFAAVGLLGTGALLAAALTLWLHVIDARFARALRLRLLSKLSRLPLGWFTSRGSGSIKKLVTDDTLA
LHYLVTHAVPDAVAAVVAPVGVLVYLFVVDWRVALVLFGPVLVYLTITSSLTIQSGPRIVQAQRWAEKMNGEAGSYLEGQPVIRVFGAASSSFRRRLDEY
IGFLVAWQRPLAGKKTLMDLATRPATFLWLIAATGTLLVATHRMDPVNLLPFMFLGTTFGARLLGIAYGLGGLRTGLLAARHLQVTLDETELAVREHPRE
PLDGEAPATVVFDHVTFGYRPGVPVIQDVSLTLRPGTVTALVGPSGSGKSTLATLLARFHDVERGAIRVGGQDIRSLAADELYTRVGFVLQEAQLVHGTA
AENIALAVPDAPAEQVQVAAREAQIHDRVLRLPDGYDTVLGANSGLSGGERQRLTIARAILGDTPVLILDEATAFADPESEYLVQQALNRLTRDRTVLVI
AHRLHTITRADQIVVLDHGRIVERGTHEELLAAGGRYCRLWDTGQGSRVAVAAAQDGTR

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.56 (0.46)	1.19 (0.39)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link